ADGRG5 Membrane Protein Introduction

Introduction of ADGRG5

ADGRG5, also known as G-protein coupled receptor 114 (GPR114) or G-protein coupled receptor PGR27 (PGR27), is a protein encoded by the ADGRG5 gene. It is a member of the adhesion GPCR family which are characterized by an extended extracellular region with a variable number of protein domains coupled to a TM7 domain via a domain known as the GPCR-Autoproteolysis INducing (GAIN) domain.

Basic Information of ADGRG5
Protein Name	Adhesion G-protein coupled receptor G5
Gene Name	ADGRG5
Aliases	G-protein coupled receptor 114, G-protein coupled receptor PGR27
Organism	Homo sapiens (Human)
UniProt ID	Q8IZF4
Transmembrane Times	7
Length (aa)	528
Sequence	MDHCGALFLCLCLLTLQNATTETWEELLSYMENMQVSRGRSSVFSSRQLHQLEQMLLNTSFPGYNLTLQT PTIQSLAFKLSCDFSGLSLTSATLKRVPQAGGQHARGQHAMQFPAELTRDACKTRPRELRLICIYFSNTH FFKDENNSSLLNNYVLGAQLSHGHVNNLRDPVNISFWHNQSLEGYTLTCVFWKEGARKQPWGGWSPEGCR TEQPSHSQVLCRCNHLTYFAVLMQLSPALVPAELLAPLTYISLVGCSISIVASLITVLLHFHFRKQSDSL TRIHMNLHASVLLLNIAFLLSPAFAMSPVPGSACTALAAALHYALLSCLTWMAIEGFNLYLLLGRVYNIY IRRYVFKLGVLGWGAPALLVLLSLSVKSSVYGPCTIPVFDSWENGTGFQNMSICWVRSPVVHSVLVMGYG GLTSLFNLVVLAWALWTLRRLRERADAPSVRACHDTVTVLGLTVLLGTTWALAFFSFGVFLLPQLFLFTI LNSLYGFFLFLWFCSQRCRSEAEAKAQIEAFSSSQTTQ

Function of ADGRG5 Membrane Protein

The G protein-coupled receptors (GPCRs) are a large family of integral membrane proteins that generally act as cell surface receptors responsible for the transduction of a remarkable diversity of endogenous signals into a cellular response. Expression of some adhesion GPCR subfamilies initially appeared confined to distinct cell types or organs, like the immune system or the central nervous system (CNS). As a member of GPCRs, ADGRG5 has the basic molecular architecture with seven hydrophobic regions of 25-35 consecutive residues. Studies have shown that ADGRG5 is specifically expressed in human eosinophils as well as in mouse lymphocytes, monocytes, macrophage, and dendritic cells. And, a variant (rs9937918) of ADGRG5 has been found to be associated with differences in vitamin D3 metabolism. What’s more, it has been reported that ADGRG5 may also have the ability to mediate hematopoietic stem cell repopulation and retention of myeloid cells within the bone marrow niche.

ADGRG5-Membrane-Protein-Introduction

Application of ADGRG5 Membrane Protein in Literature

1. Stoveken HM., et.al. Gedunin-and Khivorin-Derivatives Are Small-Molecule Partial Agonists for Adhesion G Protein-Coupled Receptors GPR56/ADGRG1 and GPR114/ADGRG5. Molecular pharmacology. 2018, 93(5): 477-88. PubMed ID: 29476042

This article finds a novel group of aGPCR partial agonists that will serve as invaluable resources for understanding the unique class receptors.

2. Wilde C., et.al. The constitutive activity of the adhesion GPCR GPR114/ADGRG5 is mediated by its tethered agonist. The FASEB Journal. 2015, 30(2): 666-73. PubMed ID: 26499266

This article suggests that the N-terminal half of the Stachel sequence confers the agonistic activity, whereas the C-terminal part orientates the agonistic core sequence to the transmembrane domain. It indicates that the proposed mechanism of Stachel-mediated activation is relevant not only to GPR114 but to a GPCRs in general.

ADGRG5 Preparation Options

To satisfy every client’s specific requirements, we have developed versatile Magic™ membrane protein production platform which enables us to provide a series of membrane protein preparation service in multiple active formats. We can provide many flexible options, from which you can find a perfect one for your particular project. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-ADGRG5 antibody development services.

Equipped with multiple leading technology platforms, Creative Biolabs is committed to delivering satisfactory membrane protein products for worldwide customers. In addition to ADGRG5 membrane protein production, we also provide other membrane protein products in the most high-quality and cost-effective way. For more detailed information, please feel free to contact us and get a quote.

All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.

	USA: Europe: Germany:
	Call us at: USA: UK: Germany:
	Fax:
	Email: