EDNRA Membrane Protein Introduction

Introduction of EDNRA

EDNRA (endothelin receptor type A), also referred as ETA, is a member of the receptor group for endothelin-1 belonging to the G protein-coupled receptor in human and encoded by EDNRA gene. Polymorphisms in this gene are associated with migraine headache resistance. EDNRA is a peptide that plays a role in potent and long-lasting vasoconstriction and cell proliferation. This receptor binds to guanine-nucleotide-binding (G) proteins, and this coupling results in the activation of a phosphatidylinositol-calcium second messenger system. It has been suggested that EDNRA can interact with HDAC7A and HTATIP.

Basic Information of EDNRA
Protein Name	Endothelin Receptor Type A
Gene Name	EDNRA
Aliases	ETA, ET-A, ETAR, ETRA, MFDA, ETA-R, hET-AR
Organism	Homo sapiens (Human)
UniProt ID	P25101
Transmembrane Times	7
Length (aa)	427
Sequence	METLCLRASFWLALVGCVISDNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLP SNGSMHNYCPQQTKITSAFKYINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGPNALIA SLALGDLIYVVIDLPINVFKLLAGRWPFDHNDFGVFLCKLFPFLQKSSVGITVLNLCALS VDRYRAVASWSRVQGIGIPLVTAIEIVSIWILSFILAIPEAIGFVMVPFEYRGEQHKTCM LNATSKFMEFYQDVKDWWLFGFYFCMPLVCTAIFYTLMTCEMLNRRNGSLRIALSEHLKQ RREVAKTVFCLVVIFALCWFPLHLSRILKKTVYNEMDKNRCELLSFLLLMDYIGINLATM NSCINPIALYFVSKKFKNCFQSCLCCCCYQSKSLMTSVPMNGTSIQWKNHDQNNHNTDRS SHKDSMN

Function of EDNRA Membrane Protein

EDNRA polymorphism is protective against generalized type of vitiligo and associated diseases. EDNRA is involved in melanocyte functions. By association with G proteins, EDNRA mediates its action that activates a phosphatidylinositol-calcium second messenger system. It was reported that EDNRA was associated with diseases including mandibulofacial dysostosis with alopecia and migraine with or without aura 1. High expression of EDNRA is associated with metastasis and poor outcome in patients with advanced bladder cancer. The prognostic value of EDNRA was successfully validated in an independent patient cohort using tissue microarrays (TMAs).

Fig.1 Scheme illustrating the possible role of Gq/G11-dependent and -independent Edn1/Ednra signaling in pharyngeal arch development.

Application of EDNRA Membrane Protein in Literature

Janosi T., et al. Differential roles of endothelin-1 ET_A and ET_B receptors and vasoactive intestinal polypeptide in regulation of the airways and the pulmonary vasculature in isolated rat lung. Experimental physiology, 2008, 93(11): 1210-1219. PubMed ID: 18567602

This article reports that VIP potently acts against the airway and pulmonary vascular constriction mediated by endothelin-1, while the ET_A and ET_B blockers exert a differential effect between airway resistance and PVR.
Georgianos P. I., et al. Endothelin A receptor antagonists in diabetic kidney disease. Current opinion in nephrology and hypertension, 2017, 26(5): 338-344. PubMed ID: 28520568

This article reveals that the hypothesis that the antiproteinuric effect of endothelin antagonism may be translated into a slower progression of diabetic nephropathy.
Trindade M., et al. Potential Role of Endothelin in Early Vascular Aging. Curr Hypertens Rev. 2017, 13(1): 33-40. PubMed ID: 28413991

Endothelin receptor antagonists were considered to be used for the treatment of some diseases like hypertension, diabetes and chronic kidney disease. However, besides pulmonary hypertension, this class is not in clinical use because of the side effects and the availability of safer drugs for the treatment of these diseases.
Kitamura Y., et al. Imbalance between expression of endothelin receptors A and B in terminal liver cirrhosis due to hepatitis C viral infection: immunohistochemical study of autopsy cases. Journal of gastroenterology and hepatology. 2008, 23(8pt2): e451-6. PubMed ID: 17565586

This article focuses on a difference in ETAR and ETBR expression among TLC, NTLC, and NCLF: the ETAR/ETBR ratio is increased in TLC due to a relative decrease in ETBR expression. This finding may be useful for the diagnosis of TLC with regard to circulatory disturbances in the liver.
Cassinotti L. R., et al. Chronic Blockade of Brain Endothelin Receptor Type-A (ET_A) Reduces Blood Pressure and Prevents Catecholaminergic Overactivity in the Right Olfactory Bulb of DOCA-Salt Hypertensive Rats. Int J Mol Sci. 2018, 27: 19(3). PubMed ID: 29495426

This article shows that ETs regulate the catecholaminergic activity and contribute to the right OB to DOCA-salt hypertension.

EDNRA Preparation Options

Aiming to obtain the soluble and functional target protein, the versatile Magic™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-EDNRA antibody development services.

Over years Creative Biolabs has successfully generated many functional membrane proteins for our customers. We are happy to tailor one-stop, custom-oriented service packages regarding a variety of membrane protein targets. Please feel free to contact us for more information.

All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.

	USA: Europe: Germany:
	Call us at: USA: UK: Germany:
	Fax:
	Email: