GHSR Membrane Protein Introduction

Introduction of GHSR

The growth hormone secretion promoting substance receptor (GHSR), also known as the G protein-coupled receptor of the ghrelin receptor that binds growth hormone secretagogues (GHSs), such as ghrelin. GHS-R1a belongs to the family of G protein-coupled receptors (GPCRs). The ghrelin binds to receptors that secrete growth hormone through the pituitary gland, and appetite-modulating factors secreted by peripheral organs. The role of GHSR is thought to be in regulating energy homeostasis and body weight.

Basic Information of GHSR
Protein Name	Growth hormone secretagogue receptor type 1
Gene Name	GHSR
Aliases	ghrelin receptor, GH-releasing peptide receptor
Organism	Homo sapiens (Human)
UniProt ID	Q92847
Transmembrane Times	7
Length (aa)	366
Sequence	MWNATPSEEPGFNLTLADLDWDASPGNDSLGDELLQLFPAPLLAGVTATCVALFVVGIAGNLLTMLVVSRFRE LRTTTNLYLSSMAFSDLLIFLCMPLDLVRLWQYRPWNFGDLLCKLFQFVSESCTYATVLTITALSVERYFAIC FPLRAKVVVTRVKLVIFVIWAVAFCSAGPIFVLVGVEHENGTDPWDTNECRPTEFAVRSGLLTVMVWVSSIFF FLPVFCLTVLYSLIGRKLWRRRRGDAVVGASLRDQNHKQTVKMLAVVVFAFILCWLPFHVGRYLFSKSFEPGS LEIAQISQYCNLVSFVLFYLSAAINPILYNIMSKKYRVAVFRLLGFEPFSQRKLSTLKDESSRAWTESSINT

Function of GHSR Membrane Protein

GHSR is involved in the secretion of GH, food intake and fat accumulation. The most important biological role of GHSR is shown by its combination with the ligand Ghrelin. GHS-R1a in pituitary cells stimulates pituitary glands to secrete growth hormone after binding to ghrelin. GHSR combined with Gerlin induces appetite or hunger. Moreover, the pathway activated by binding of ghrelin to the growth hormone secretagogue receptor, GHSR1a, regulates the activation of the downstream mitogen-activated protein kinase, Akt, nitric oxide synthase, and AMPK cascades in different cellular systems. The growth hormone secretagogue receptor may also be linked to learning and memory.

GHSR Membrane Protein Introduction Fig.1 GHSR induced mechanism of signal transduction in relation to the IR.

Application of GHSR in Literature

Tomoyuki Kurashina., et al. The β-cell GHSR and downstream cAMP/TRPM2 signaling account for insulinostatic and glycemic effects of ghrelin. Scientific Reports. 2015, 5: 14041. PubMed ID: 26370322

This article reports that the direct interaction of ghrelin with GHSR attenuates glucose-induced insulin release; novel beta-cell-specific GHSR-cAMP/TRPM2 signaling provides a potential therapeutic target for the treatment of type 2 diabetes.
Ligen Lin.,et al. Ghrelin Receptor Regulates Appetite and Satiety during Aging in Mice by Regulating Meal Frequency and Portion Size but Not Total Food Intake. The Journal of Nutrition. 2014, 144(9): 1349-55. PubMed ID: 24991043

This article reveals that GHS-R ablation can regulate dietary patterns by regulating hypothalamic neuropeptides to regulate feeding behavior.
Ligen Lin., et al. Ablation of ghrelin receptor reduces adiposity and improves insulin sensitivity during aging by regulating fat metabolism in white and brown adipose tissues. Aqing cell. 2011, 10(6): 996-1010. PubMed ID: 28639411

In this paper, it shows that GHS-R plays an important role in heat-induced damage during aging. GHSR antagonists can shift energy balance from obesity to heat production to fight obesity.
Zhen-ze Liu., et al. Growth hormone secretagogue receptor is important in the development of experimental colitis. Cell&Bioscience. 2015, 5(1): 12. PubMed ID: 25825652

This article reports that GHSR up-regulates inflammatory cytokines and macrophage activation, which promotes the development of acute DSS-induced colitis and serves as a potential therapeutic target for IBD.
Amanda K.E., et al. Short-term calorie restriction enhances adult hippocampal neurogenesis and remote fear memory in a Ghsr-dependent manner. Psychoneuroendocrinology. 2016, 63: 198-207. PubMed ID: 26460782

This article shows that the GHSR is enriched in the neurogenic niche of the hippocampal dentate gyrus (DG) and GHSR mediates the beneficial effects of CR on enhancing adult hippocampal neurogenesis and memory.

GHSR Preparation Options

To obtain the soluble and functional target protein, the versatile Magic™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-GHSR antibody development services.

As a forward-looking research institute as well as a leading customer service provider in the field of membrane protein, Creative Biolabs has won good reputation among our worldwide customers for successfully accomplishing numerous challenging projects including generation of many functional membrane proteins. Please feel free to contact us for more information.

Reference

Iryna Liauchonak, et al. (2018). The Biased G-Protein-Coupled Receptor Agonism Bridges the Gap between the Insulin Receptor and the Metabolic Syndrome. Int. J. Mol. Sci. 19(2), 575.

All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.

	USA: Europe: Germany:
	Call us at: USA: UK: Germany:
	Fax:
	Email: