GNRHR2 Membrane Protein Introduction

Introduction of GNRHR2

The putative gonadotropin-releasing hormone II receptor (GNRHR2) is a receptor protein encoded by gene GNRHR2. This receptor is a member of the G-protein coupled receptor 1 (GPCR1) family and expressed in many tissues. Putative receptor for gonadotropin releasing hormone II (GnRH II) is most probably non-functional.

Basic Information of GNRHR2

Protein Name	Putative gonadotropin-releasing hormone II receptor
Gene Name	GNRHR2
Aliases	GnRH II receptor, GnRH-II-R, GNRR2, Type II GnRH receptor
Organism	Homo sapiens (Human)
UniProt ID	Q96P88
Transmembrane Times	5
Length (aa)	292
Sequence	MSAGNGTPWDATWNITVQWLAVDIACRTLMFLKLMATYSAAFLPVVIGLDRQAAVLNPLG SRSGVRKLLGAAWGLSFLLAFPQLFLFHTVHCAGPVPFTQCVTKGSFKAQWQETTYNLFT FCCLFLLPLTAMAICYSRIVLSVSRPQTRKGSHAPAGEFALPRSFDNCPRVRLRALRLAL LILLTFILCWTPYYLLGMWYWFSPTMLTEVPPSLSHILFLLGLLNAPLDPLLYGAFTLGC RRGHQELSIDSSKEGSGRMLQEEIHAFRQLEVQKTVTSRRAGETKGISITSI

Function of GNRHR2 Membrane Protein

GNRHR2 is a receptor for gonadotropin-releasing hormone II (GnRH2). The role of GnRH2 and its receptors in mammals has been elusive, probably due to the lack of ligands and receptors in common laboratory models. In fact, GnRH2 and its receptors are not physiological regulators of gonadotropin secretion in mammals. In peripheral tissues, GnRH2 and its receptors are new regulators of the reproductive organs.

GNRHR2 Membrane Protein Introduction

Application of GNRHR2 Membrane Protein in Literature

Amy T., et al. Expression and Role of Gonadotropin-Releasing Hormone 2 and Its Receptor in Mammals. Front Endocrinol (Lausanne). 2017, 8: 269. PubMed ID: 29312140

This article reports that GnRH2 and its receptors can coordinate the interaction between nutritional status and sexual behavior in female brains, helping to mediate female placental function, implantation and ovarian steroidogenesis.
Desaulniers A.T., et al. Production of a gonadotropin-releasing hormone 2 receptor knockdown (GNRHR2 KD) swine line. Transgenic Res. 2017, 26(4): 567–575. PubMed ID: 28534229

This article reveals that GNRH2 and GNRHR2 mediate LH-independent testosterone secretion in pig testes.
Brauer V.M., et al. Functional activity of the porcine Gnrhr2 gene promoter in testis-derived cells is partially conferred by nuclear factor-κB, specificity protein 1 and 3 (SP1/3) and overlapping early growth response 1/SP1/3 binding sites. Gene. 2016, 587.2: 137-146. PubMed ID: 27134031

This research demonstrates that NF-κB, SP1/3 and overlapping EGR1/SP1/3 binding sites are pivotal to the expression of the porcine Gnrhr2 gene in ST cells.

GNRHR2 Preparation Options

To obtain the soluble and functional target protein, the versatile Magic™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-GNRHR2 antibody development services.

As a forward-looking research institute as well as a leading custom service provider in the field of membrane protein, Creative Biolabs has won good reputation among our worldwide customers for successfully accomplishing numerous challenging projects including generation of many functional membrane proteins. Please feel free to contact us for more information.

All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.

	USA: Europe: Germany:
	Call us at: USA: UK: Germany:
	Fax:
	Email: