GPR148 Membrane Protein Introduction

Introduction of GPR148

GPR148 is encoded by the GPR148 gene, which is located at 2q14.3 in human. It is a seven transmembrane protein and also a 347 amino acid long receptor protein and also known as BTR or PGR6. GPR148 belongs to the G-protein-coupled receptor (GPCR) family which is the largest family of surface molecules involved in signal transduction and they are activated by a large variety of ligands, including hormones, growth factors, light, peptides, neurotransmitters, nucleotides and odorants, and are involved in the regulation of a range of cellular responses.

Basic Information of GPR148
Protein Name	Probable G-protein coupled receptor 148
Gene Name	GPR148
Aliases	Brain and testis restricted GPCR, G-protein coupled receptor PGR6
Organism	Homo sapiens (Human)
UniProt ID	Q8TDV2
Transmembrane Times	7
Length (aa)	347
Sequence	MGDELAPCPVGTTAWPALIQLISKTPCMPQAASNTSLGLGDLRVPSSMLYWLFLPSSLLAAATLAVSPLLLVTILRNQRLRQEPHYLLPANILLSDLAYILLHMLISSSSLGGWELGRMACGILTDAVFAACTSTILSFTAIVLHTYLAVIHPLRYLSFMSHGAAWKAVALIWLVACCFPTFLIWLSKWQDAQLEEQGASYILPPSMGTQPGCGLLVIVTYTSILCVLFLCTALIANCFWRIYAEAKTSGIWGQGYSRARGTLLIHSVLITLYVSTGVVFSLDMVLTRYHHIDSGTHTWLLAANSEVLMMLPRAMLTYLYLLRYRQLLGMVRGHLPSRRHQAIFTIS

Function of GPR148 Membrane Protein

GPR148 was firstly described in 2004 and was named brain testis restricted (BTR), due to its restricted expression in normal tissues, and it is expressed primarily in nervous system and testis. But it was also found in several tumor types, most notably prostate cancer. There is a significant correlation between GPR148 expression and prostate cancer, which suggests a potential role for BTR as a marker for detection of this type of cancer. Beyond that, GPR148 may be the possible candidate gene, which is involved in developmental delay (DD)/intellectual disability (ID), attention-deficit hyperactivity disorder (ADHD), and neurobehavioral abnormalities due to deletion of chromosome 2q21.1. Last but not least, prostanoid is a potential ligand association for GPR148 according to current studies.

Fig.1 GPCR signaling pathways (Thomsen, 2005).

Application of GPR148 Membrane Protein in Literature

Dharmadhikari A.V., et al. Small rare recurrent deletions and reciprocal duplications in 2q21.1, including brain-specific ARHGEF4 and GPR148. Human Molecular Genetics. 2012, 21(15): 3345. PubMed ID: 22543972

This article suggests that small rare recurrent deletion of 2q21.1, including brain-specific ARHGEF4 and GPR148 is pathogenic for DD/ID, ADHD, epilepsy and other neurobehavioral abnormalities.
Parmigiani R.B., et al. A novel human G protein-coupled receptor is over-expressed in prostate cancer. Genet. Mol. Res. 2004, 3(4): 521-531. PubMed ID: 15688318

This article identified a new G protein-coupled receptor, GPR148, with the availability of the human genome sequence databases. It also reveals that GPR148 is associated with prostate cancer.
Gimelli S., et al. Recurrent microdeletion 2q21.1: report on a new patient with neurological disorders. American Journal of Medical Genetics Part A. 2014, 164(3): 801-805. PubMed ID: 24591035

Authors in this group have identified an individual with a small, rare deletion on chromosome 2q21.1 with psychomotor delay, hyperactivity, and aggressive behavior. The rearranged region is flanked by large complex low-copy repeats and includes GPR148.
Kakarala K.K. and Jamil K. Sequence-structure based phylogeny of GPCR Class A Rhodopsin receptors. Molecular Phylogenetics & Evolution. 2014, 76(1): 293-297. PubMed ID: 24503482

This study was able to identify potential ligand association for Class A Orphans and putative/unclassified Class A receptors with no cognate ligand information. And GPR148 is one of them.

GPR148 Preparation Options

To obtain the soluble and functional target protein, the versatile Magic™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-GPR148 antibody development services.

As a forward-looking research institute as well as a leading customer service provider in the field of membrane protein, Creative Biolabs has won good reputation among our worldwide customers for successfully accomplishing numerous challenging projects including generation of many functional membrane proteins. Please feel free to contact us for more information.

Reference

Thomsen, W. and Frazer, J.D. (2005). Functional assays for screening gpcr targets. Current Opinion in Biotechnology. 16(6), 655-665.

All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.

	USA: Europe: Germany:
	Call us at: USA: UK: Germany:
	Fax:
	Email: