GRM8 Membrane Protein Introduction

Introduction of GRM8

GRM8 (mGluR8) is a group III metabotropic glutamate receptor (mGluR) and it is a member of family C G-protein coupled receptor. As with other mGluRs, this receptor has a large extracellular domain, termed the Venus Flytrap domain, which contains the glutamate-binding site. GRM8 is expressed at lower levels than the other group III mGluRs but is widely distributed in the brain. It is discovered to be localized mainly presynaptically where it regulates neurotransmitter release but is also identified in some postsynaptic locations and in the periphery. The gene coding GRM8 is exceptionally large, spanning about 1000 kb of genomic DNA.

Basic Information of GRM8
Protein Name	Metabotropic glutamate receptor 8
Gene Name	GRM8
Organism	Homo sapiens (Human)
UniProt ID	O00222
Transmembrane Times	7
Length (aa)	908
Sequence	MVCEGKRSASCPCFFLLTAKFYWILTMMQRTHSQEYAHSIRVDGDIILGGLFPVHAKGER GVPCGELKKEKGIHRLEAMLYAIDQINKDPDLLSNITLGVRILDTCSRDTYALEQSLTFV QALIEKDASDVKCANGDPPIFTKPDKISGVIGAAASSVSIMVANILRLFKIPQISYASTA PELSDNTRYDFFSRVVPPDSYQAQAMVDIVTALGWNYVSTLASEGNYGESGVEAFTQISR EIGGVCIAQSQKIPREPRPGEFEKIIKRLLETPNARAVIMFANEDDIRRILEAAKKLNQS GHFLWIGSDSWGSKIAPVYQQEEIAEGAVTILPKRASIDGFDRYFRSRTLANNRRNVWFA EFWEENFGCKLGSHGKRNSHIKKCTGLERIARDSSYEQEGKVQFVIDAVYSMAYALHNMH KDLCPGYIGLCPRMSTIDGKELLGYIRAVNFNGSAGTPVTFNENGDAPGRYDIFQYQITN KSTEYKVIGHWTNQLHLKVEDMQWAHREHTHPASVCSLPCKPGERKKTVKGVPCCWHCER CEGYNYQVDELSCELCPLDQRPNMNRTGCQLIPIIKLEWHSPWAVVPVFVAILGIIATTF VIVTFVRYNDTPIVRASGRELSYVLLTGIFLCYSITFLMIAAPDTIICSFRRVFLGLGMC FSYAALLTKTNRIHRIFEQGKKSVTAPKFISPASQLVITFSLISVQLLGVFVWFVVDPPH IIIDYGEQRTLDPEKARGVLKCDISDLSLICSLGYSILLMVTCTVYAIKTRGVPETFNEA KPIGFTMYTTCIIWLAFIPIFFGTAQSAEKMYIQTTTLTVSMSLSASVSLGMLYMPKVYI IIFHPEQNVQKRKRSFKAVVTAATMQSKLIQKGNDRPNGEVKSELCESLETNTSSTKTTY ISYSNHSI

Functions of GRM8 Membrane Protein

GRM8 knockout mice are found to show enhanced anxiety and weight gain compared to normal animals. The severity degree of anxiety-behaviors is sex-dependent. Moreover, a null mutation in the GRM8 gene resulted in robust cognitive performance deficits and spatial learning. Because of the important roles in modulating neurotransmission, GRM8 has been regarded as attractive therapeutic target for anxiety disorders. Besides, the expression of this receptor in peripheral tissues, such as the gut and pancreas, may play a role in gastrointestinal motility and insulin secretion in vivo. More specific functions of mGluR8 remain to be established.

GRM8 Membrane Protein Introduction

Applications of GRM8 Membrane Protein in Literature

Bahi A. Decreased anxiety, voluntary ethanol intake and ethanol-induced CPP acquisition following activation of the metabotropic glutamate receptor 8 "mGluR8". Pharmacology Biochemistry & Behavior. 2017, 155: 32. PubMed ID: 28322866

This study investigated the effects of mGluR8 activation on anxiety-like behavior, voluntary ethanol intake, and ethanol-induced conditioned reward. The results showed that the activation of this receptor reduced voluntary ethanol intake and that the mGluR8 signaling might contribute to the rewarding properties of ethanol.
Govea R. M., et al. Group III mGluR8 negatively modulates TRPA1. Neuroscience. 2016, 334: 134-147. PubMed ID: 27497709

This study investigated the interaction between group III mGluRs (mGluR8) and transient receptor potential ankyrin 1 (TRPA1) on cutaneous nociceptors in rats. The results showed that the agonists of group III mGluRs might be effective in the treatment of mechanical hypersensitivity.
Li W., et al. Significant association of GRM7 and GRM8 genes with schizophrenia and major depressive disorder in the Han Chinese population. European Neuropsychopharmacology. 2016, 26(1): 136-146. PubMed ID: 26655190

This study demonstrated the genetic association of GRM7 and GMR8 with schizophrenia and major depressive disorders in the Han Chinese population.
DuvoisinR. M., et al. Acute pharmacological modulation of mGluR8 reduces measures of anxiety. Behavioural Brain Research. 2010, 212(2): 168-173. PubMed ID: 20385173

This article assessed the potential effects of acute pharmacological modulation of mGluR8 on anxiety. mGluR8 was stimulated with specific agonist DCPG or modulated with AZ12216052, a new, positive allosteric modulator. The results showed that mGluR8 might be a promising therapeutic target for anxiety.

GRM8 Preparation Options

Creative Biolabs has developed a robust platform for the preparation of purified, stabilized, and functional membrane proteins facilitating your basic scientific research and discovery projects. Our platform enables us to reconstitute your target proteins in stable and functional conformations that maximally preserves their activities. Please see Magic™ membrane protein production platform for more information. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-GRM8 antibody development services.

Over years, our scientists have accumulated considerable experience in the completion of many difficult-to-prepare membrane proteins. We are happy to share our expertise with our valued clients to tailor one-stop, custom-oriented service packages regarding a wide range of membrane protein targets. Contact us to experience the great value of our excellent services.

All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.

	USA: Europe: Germany:
	Call us at: USA: UK: Germany:
	Fax:
	Email: