Close
Close

Magic™ Membrane Protein Human ABCB1 (ATP binding cassette subfamily B member 1) Expressed in E.coli with 6xHis tag at the N-terminus for Antibody Discovery, Partial (236-297aa) (CAT#: MPX4438K)

Datasheet
This product is a 10.8kDa Human ABCB1 membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • ABCB1
  • Protein Length
  • Partial (236-297aa)
  • Protein Class
  • Transporter
  • Molecular Weight
  • 10.8kDa
  • TMD
  • 12
  • Sequence
  • LSSFTDKELLAYAKAGAVAEEVLAAIRTVIAFGGQKKELERYNKNLEEAKRIGIKKAITANI

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • 6xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Purity
  • >90% as determined by SDS-PAGE
  • Buffer
  • Tris-based buffer, 50% glycerol

Target

  • Target Protein
  • ABCB1
  • Full Name
  • ATP binding cassette subfamily B member 1
  • Introduction
  • The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance. The protein encoded by this gene is an ATP-dependent drug efflux pump for xenobiotic compounds with broad substrate specificity. It is responsible for decreased drug accumulation in multidrug-resistant cells and often mediates the development of resistance to anticancer drugs. This protein also functions as a transporter in the blood-brain barrier. Mutations in this gene are associated with colchicine resistance and Inflammatory bowel disease 13. Alternative splicing and the use of alternative promoters results in multiple transcript variants.
  • Alternative Names
  • CLCS; MDR1; P-GP; PGY1; ABC20; CD243; GP170; p-170; ATP-dependent translocase ABCB1; ATP-binding cassette, sub-family B (MDR/TAP), member 1; P-glycoprotein 1; colchicin sensitivity; doxorubicin resistance; multidrug resistance protein 1; phospholipid transporter ABCB1; ABCB1; ATP binding cassette subfamily B member 1

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us