Close
Close

Magic™ Membrane Protein Human ACVR2B (Activin A receptor type 2B) Expressed in Baculovirus/Insect expression system for Antibody Discovery, Partial (19-134aa) (CAT#: MPX0207K)

Datasheet
This product is a 41 kDa Human ACVR2B membrane protein expressed in Baculovirus/Insect expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • ACVR2B
  • Protein Length
  • Partial (19-134aa)
  • Protein Class
  • Transferase
  • Molecular Weight
  • 41 kDa
  • TMD
  • 1
  • Sequence
  • SGRGEAETRECIYYNANWELERTNQSGLERCE
    GEQDKRLHCYASWRNSSGTIELVKKGCWLDDFNCYDRQECVATEENPQVY
    FCCCEGNFCNERFTHLPEAGGPEVTYEPPPTAPT

Product Description

  • Expression Systems
  • Baculovirus/Insect expression system
  • Tag
  • hIgG1 Fc and 6xHis tag at the C-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 100 μg/mL in sterile PBS.
  • Endotoxin
  • <0.10 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >95%, by SDS-PAGE under reducing conditions and visualized by silver stain
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS.

Target

  • Target Protein
  • ACVR2B
  • Full Name
  • Activin A receptor type 2B
  • Introduction
  • Activins are dimeric growth and differentiation factors which belong to the transforming growth factor-beta (TGF-beta) superfamily of structurally related signaling proteins. Activins signal through a heteromeric complex of receptor serine kinases which include at least two type I (I and IB) and two type II (II and IIB) receptors. These receptors are all transmembrane proteins, composed of a ligand-binding extracellular domain with cysteine-rich region, a transmembrane domain, and a cytoplasmic domain with predicted serine/threonine specificity. Type I receptors are essential for signaling; and type II receptors are required for binding ligands and for expression of type I receptors. Type I and II receptors form a stable complex after ligand binding, resulting in phosphorylation of type I receptors by type II receptors. Type II receptors are considered to be constitutively active kinases. This gene encodes activin A type IIB receptor, which displays a 3- to 4-fold higher affinity for the ligand than activin A type II receptor.
  • Alternative Names
  • ACVR2B; HTX4; ACTRIIB; ActR-IIB; activin receptor type-2B; activin A receptor, type IIB; Activin A receptor type 2B
  • Gene ID
  • 93

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us