Close

Magic™ Membrane Protein Human ACVRL1 (Activin A receptor like type 1) Expressed in NS0 for Antibody Discovery, Partial (22-118aa) (CAT#: MPX0266K)

This product is a 37.3 kDa Human ACVRL1 membrane protein expressed in NS0. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • ACVRL1
  • Protein Length
  • Partial (22-118aa)
  • Protein Class
  • Transferase
  • Molecular Weight
  • 37.3 kDa
  • TMD
  • 1
  • Sequence
  • DPVKPSRGPLVTCTCESPHCKGPTCRGAW
    CTVVLVREEGRHPQEHRGCGNLHRELCRGRPTEFVNHYCCDSHLCNHNVS
    LVLEATQPPSEQPGTDGQ

Product Description

  • Expression Systems
  • NS0
  • Tag
  • hIgG1 Fc tag at the C-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 100 μg/mL in sterile PBS.
  • Endotoxin
  • <0.10 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >90%, by SDS-PAGE under reducing conditions and visualized by silver stain
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS.

Target

  • Target Protein
  • ACVRL1
  • Full Name
  • Activin A receptor like type 1
  • Introduction
  • This gene encodes a type I cell-surface receptor for the TGF-beta superfamily of ligands. It shares with other type I receptors a high degree of similarity in serine-threonine kinase subdomains, a glycine- and serine-rich region (called the GS domain) preceding the kinase domain, and a short C-terminal tail. The encoded protein, sometimes termed ALK1, shares similar domain structures with other closely related ALK or activin receptor-like kinase proteins that form a subfamily of receptor serine/threonine kinases. Mutations in this gene are associated with hemorrhagic telangiectasia type 2, also known as Rendu-Osler-Weber syndrome 2.
  • Alternative Names
  • ACVRL1; HHT; ALK1; HHT2; ORW2; SKR3; ALK-1; TSR-I; ACVRLK1; serine/threonine-protein kinase receptor R3; TGF-B superfamily receptor type I; activin A receptor type II-like 1; activin A receptor type IL; activin A receptor, type II-like kinase 1; Activin A receptor like type 1
  • Gene ID
  • 94

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us