Close

Magic™ Membrane Protein Human ALPP (Alkaline phosphatase, placental) Expressed in E.coli with 10xHis tag at the N-terminus for Antibody Discovery, Partial (117-447aa) (CAT#: MPX4300K)

This product is a 41.9 kDa Human ALPP membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • ALPP
  • Protein Length
  • Partial (117-447aa)
  • Protein Class
  • Receptor
  • Molecular Weight
  • 41.9 kDa
  • TMD
  • 1
  • Sequence
  • TATAYLCGVKGNFQTIGLSAAARFNQCNTTRGNEVISVMNRAKKAGKSVGVVTTTRVQHASPAGTYAHTVNRNWYSDADVPASARQEGCQDIATQLISNMDIDVILGGGRKYMFRMGTPDPEYPDDYSQGGTRLDGKNLVQEWLAKRQGARYVWNRTELMQASLDPSVTHLMGLFEPGDMKYEIHRDSTLDPSLMEMTEAALRLLSRNPRGFFLFVEGGRIDHGHHESRAYRALTETIMFDDAIERAGQLTSEEDTLSLVTADHSHVFSFGGYPLRGSSIFGLAPGKARDRKAYTVLLYGNGPGYVLKDGARPDVTESESGSPEYRQQSAV

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • 10xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Purity
  • >85% as determined by SDS-PAGE
  • Buffer
  • Tris-based buffer, 50% glycerol

Target

  • Target Protein
  • ALPP
  • Full Name
  • Alkaline phosphatase, placental
  • Introduction
  • The protein encoded by this gene is an alkaline phosphatase, a metalloenzyme that catalyzes the hydrolysis of phosphoric acid monoesters. It belongs to a multigene family composed of four alkaline phosphatase isoenzymes. The enzyme functions as a homodimer and has a catalytic site containing one magnesium and two zinc ions, which are required for its enzymatic function. One of the main sources of this enzyme is the liver, and thus, it's one of several indicators of liver injury in different clinical conditions. In pregnant women, this protein is primarily expressed in placental and endometrial tissue, however, strong ectopic expression has been detected in ovarian adenocarcinoma, serous cystadenocarcinoma, and other ovarian cancer cells.
  • Alternative Names
  • ALPP; ALP; IAP; ALPI; PALP; PLAP; PLAP-1; alkaline phosphatase, placental type; Intestinal alkaline phosphatase; Intestinal-type alkaline phosphatase; alkaline phosphatase Regan isozyme; alkaline phosphomonoesterase; glycerophosphatase; placental alkaline phosphatase 1; Alkaline phosphatase, placental

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us