Close

Magic™ Membrane Protein Human ANPEP (Alanyl aminopeptidase, membrane) Expressed in E.coli with 10xHis and GST tag at the N-terminus, Myc tag at the C-terminus for Antibody Discovery, Partial (34-219aa) (CAT#: MPX4166K)

This product is a 55.8 kDa Human ANPEP membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • ANPEP
  • Protein Length
  • Partial (34-219aa)
  • Protein Class
  • Receptor
  • Molecular Weight
  • 55.8 kDa
  • TMD
  • 1
  • Sequence
  • SQEKNKNANSSPVASTTPSASATTNPASATTLDQSKAWNRYRLPNTLKPDSYRVTLRPYLTPNDRGLYVFKGSSTVRFTCKEATDVIIIHSKKLNYTLSQGHRVVLRGVGGSQPPDIDKTELVEPTEYLVVHLKGSLVKDSQYEMDSEFEGELADDLAGFYRSEYMEGNVRKVVATTQMQAADARK

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • 10xHis and GST tag at the N-terminus, Myc tag at the C-terminus
  • Protein Format
  • Soluble
  • Purity
  • >85% as determined by SDS-PAGE.
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • ANPEP
  • Full Name
  • Alanyl aminopeptidase, membrane
  • Introduction
  • Aminopeptidase N is located in the small-intestinal and renal microvillar membrane, and also in other plasma membranes. In the small intestine aminopeptidase N plays a role in the final digestion of peptides generated from hydrolysis of proteins by gastric and pancreatic proteases. Its function in proximal tubular epithelial cells and other cell types is less clear. The large extracellular carboxyterminal domain contains a pentapeptide consensus sequence characteristic of members of the zinc-binding metalloproteinase superfamily. Sequence comparisons with known enzymes of this class showed that CD13 and aminopeptidase N are identical. The latter enzyme was thought to be involved in the metabolism of regulatory peptides by diverse cell types, including small intestinal and renal tubular epithelial cells, macrophages, granulocytes, and synaptic membranes from the CNS. This membrane-bound zinc metalloprotease is known to serve as a receptor for the HCoV-229E alphacoronavirus as well as other non-human coronaviruses. This gene has also been shown to promote angiogenesis, tumor growth, and metastasis and defects in this gene are associated with various types of leukemia and lymphoma.
  • Alternative Names
  • ANPEP; APN; CD13; LAP1; P150; PEPN; GP150; aminopeptidase N; AP-M; AP-N; alanyl (membrane) aminopeptidase; aminopeptidase M; hAPN; membrane alanyl aminopeptidase; microsomal aminopeptidase; myeloid plasma membrane glycoprotein CD13; Alanyl aminopeptidase, membrane

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us