Close

Magic™ Membrane Protein Human AQP4 (Aquaporin 4) Expressed in E.coli with 6xHis and SUMO tag at the N-terminus for Antibody Discovery, Partial (253-323aa) (CAT#: MPX4255K)

This product is a 24.0kDa Human AQP4 membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • AQP4
  • Protein Length
  • Partial (253-323aa)
  • Protein Class
  • Transporter
  • Molecular Weight
  • 24.0kDa
  • TMD
  • 6
  • Sequence
  • CPDVEFKRRFKEAFSKAAQQTKGSYMEVEDNRSQVETDDLILKPGVVHVIDVDRGEEKKGKDQSGEVLSSV

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • 6xHis and SUMO tag at the N-terminus
  • Protein Format
  • Soluble
  • Purity
  • >90% as determined by SDS-PAGE
  • Buffer
  • Tris-based buffer, 50% glycerol

Target

  • Target Protein
  • AQP4
  • Full Name
  • Aquaporin 4
  • Introduction
  • This gene encodes a member of the aquaporin family of intrinsic membrane proteins that function as water-selective channels in the plasma membranes of many cells. This protein is the predominant aquaporin found in brain and has an important role in brain water homeostasis. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. Additional isoforms, resulting from the use of alternative in-frame translation initiation codons, have also been described. Recent studies provided evidence for translational readthrough in this gene, and expression of C-terminally extended isoforms via the use of an alternative in-frame translation termination codon.
  • Alternative Names
  • MIWC; WCH4; aquaporin-4; aquaporin type4; mercurial-insensitive water channel; AQP4; Aquaporin 4

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us