Close

Magic™ Membrane Protein Human ARL6IP1 (ADP ribosylation factor like GTPase 6 interacting protein 1) Expressed in vitro E.coli expression system, Full Length (CAT#: MPX2187K)

This product is a Human ARL6IP1 membrane protein expressed in vitro E.coli expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • ARL6IP1
  • Protein Length
  • Full Length
  • Protein Class
  • Receptor
  • TMD
  • 3
  • Sequence
  • MAEGDNRSTNLLAAETASLEEQLQGWGEVMLMADKVLRWERAWFPPAIMGVVSLVFLIIYYLDPSVLSGVSCFVMFLCLADYLVPILAPRIFGSNKWTTEQQQRFHEICSNLVKTRRRAVGWWKRLFTLKEEKPKMYFMTMIVSLAAVAWVGQQVHNLLLTYLIVTSLLLLPGLNQHGIILKYIGMAKREINKLLKQKEKKNE

Product Description

  • Expression Systems
  • in vitro E.coli expression system
  • Tag
  • 10xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • ARL6IP1
  • Full Name
  • ADP ribosylation factor like GTPase 6 interacting protein 1
  • Introduction
  • This gene belongs to the ARL6ip family and encodes a transmembrane protein that is predominantly localized to intracytoplasmic membranes. It is highly expressed in early myeloid progenitor cells and thought to be involved in protein transport, membrane trafficking, or cell signaling during hematopoietic maturation. Mutations in this gene are associated with spastic paraplegia 61 (SPG61). Alternatively spliced transcript variants have been found for this gene.
  • Alternative Names
  • ARL6IP1; AIP1; ARMER; SPG61; ARL6IP; ADP-ribosylation factor GTPase 6 interacting protein 1; ADP-ribosylation factor-like 6 interacting protein 1; ARL-6-interacting protein 1; aip-1; apoptotic regulator in the membrane of the endoplasmic reticulum; ADP ribosylation factor like GTPase 6 interacting protein 1

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us