Close

Magic™ Membrane Protein Human ARL6IP5 (ADP ribosylation factor like GTPase 6 interacting protein 5) Expressed in vitro E.coli expression system, Full Length (CAT#: MPX2166K)

This product is a Human ARL6IP5 membrane protein expressed in vitro E.coli expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • ARL6IP5
  • Protein Length
  • Full Length
  • Protein Class
  • Receptor
  • TMD
  • 4
  • Sequence
  • MDVNIAPLRAWDDFFPGSDRFARPDFRDISKWNNRVVSNLLYYQTNYLVVAAMMISIVGFLSPFNMILGGIVVVLVFTGFVWAAHNKDVLRRMKKRYPTTFVMVVMLASYFLISMFGGVMVFVFGITFPLLLMFIHASLRLRNLKNKLENKMEGIGLKRTPMGIVLDALEQQEEGINRLTDYISKVKE

Product Description

  • Expression Systems
  • in vitro E.coli expression system
  • Tag
  • 10xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • ARL6IP5
  • Full Name
  • ADP ribosylation factor like GTPase 6 interacting protein 5
  • Introduction
  • Expression of this gene is affected by vitamin A. The encoded protein of this gene may be associated with the cytoskeleton. A similar protein in rats may play a role in the regulation of cell differentiation. The rat protein binds and inhibits the cell membrane glutamate transporter EAAC1. The expression of the rat gene is upregulated by retinoic acid, which results in a specific reduction in EAAC1-mediated glutamate transport.
  • Alternative Names
  • ARL6IP5; JWA; jmx; hp22; PRAF3; Yip6b; DERP11; HSPC127; addicsin; GTRAP3-18; PRA1 family protein 3; ADP-ribosylation factor GTPase 6 interacting protein 5; ADP-ribosylation factor-like 6 interacting protein 5; ADP-ribosylation factor-like protein 6-interacting protein 5; ADP-ribosylation-like factor 6 interacting protein 5; ARL-6-interacting protein 5; JM5; PRA1 domain family 3; aip-5; cytoskeleton-related vitamin A-responsive protein; dermal papilla derived protein 11; glutamate transporter EAAC1-interacting protein; glutamate transporter EEAC1-associated protein; prenylated Rab acceptor protein 2; protein JWa; putative MAPK activating protein PM27; ADP ribosylation factor like GTPase 6 interacting protein 5

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us