Close
Close

Magic™ Membrane Protein Human ATP5MF (ATP synthase membrane subunit f) Full Length (CAT#: MPC2964K) Made to Order

Datasheet
This product is a made-to-order Human ATP5MF membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • ATP5MF
  • Protein Length
  • Full length
  • Protein Class
  • Transporter
  • TMD
  • 1
  • Sequence
  • MASVGECPAPVPVKDKKLLEVKLGELPSWILMRDFSPSGIFGAFQRGYYR
    YYNKYINVKKGSISGITMVLACYVLFSYSFSYKHLKHERLRKYH

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Flag-StrepII or based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements (Detergent, Liposome, Nanodisc, SMALPs, VLP)

Target

  • Target Protein
  • ATP5MF
  • Full Name
  • ATP synthase membrane subunit f
  • Introduction
  • Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. It is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, which comprises the proton channel. The catalytic portion of mitochondrial ATP synthase consists of five different subunits (alpha, beta, gamma, delta, and epsilon) assembled with a stoichiometry of 3 alpha, 3 beta, and single representatives of the gamma, delta, and epsilon subunits. The proton channel likely has nine subunits (a, b, c, d, e, f, g, F6 and 8). This gene encodes the f subunit of the Fo complex. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene. This gene has multiple pseudogenes. Naturally occurring read-through transcription also exists between this gene and the downstream pentatricopeptide repeat domain 1 (PTCD1) gene.
  • Alternative Names
  • ATP5MF; ATP5J2; ATP5JL; ATP synthase subunit f, mitochondrial; ATP synthase f chain, mitochondrial; ATP synthase, H+ transporting, mitochondrial F0 complex, subunit f; ATP synthase, H+ transporting, mitochondrial Fo complex subunit F2; F1F0-type ATPase subunit f; F1Fo-ATP synthase complex Fo membrane domain f subunit; F1Fo-ATPase synthase f subunit; ATP synthase membrane subunit f

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us