Close

Magic™ Membrane Protein Human BCAP31 (B cell receptor associated protein 31) Expressed in E.coli with GST tag at the N-terminus for Antibody Discovery, Partial (2-243aa) (CAT#: MPX4223K)

This product is a 54.5kDa Human BCAP31 membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • BCAP31
  • Protein Length
  • Partial (2-243aa)
  • Protein Class
  • Transporter
  • Molecular Weight
  • 54.5kDa
  • TMD
  • 3
  • Sequence
  • SLQWTAVATFLYAEVFVVLLLCIPFISPKRWQKIFKSRLVELLVSYGNTFFVVLIVILVLLVIDAVREIRKYDDVTEKVNLQNNPGAMEHFHMKLFRAQRNLYIAGFSLLLSFLLRRLVTLISQQATLLASNEAFKKQAESASEAAKKYMEENDQLKKGAAVDGGKLDVGNAEVKLEEENRSLKADLQKLKDELASTKQKLEKAENQVLAMRKQSEGLTKEYDRLLEEHAKLQAAVDGPMDK

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • GST tag at the N-terminus
  • Protein Format
  • Soluble
  • Purity
  • >90% as determined by SDS-PAGE
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • BCAP31
  • Full Name
  • B cell receptor associated protein 31
  • Introduction
  • This gene encodes a member of the B-cell receptor associated protein 31 superfamily. The encoded protein is a multi-pass transmembrane protein of the endoplasmic reticulum that is involved in the anterograde transport of membrane proteins from the endoplasmic reticulum to the Golgi and in caspase 8-mediated apoptosis. Microdeletions in this gene are associated with contiguous ABCD1/DXS1375E deletion syndrome (CADDS), a neonatal disorder. Alternative splicing of this gene results in multiple transcript variants. Two related pseudogenes have been identified on chromosome 16.
  • Alternative Names
  • BCAP31; CDM; DDCH; BAP31; 6C6-AG; DXS1357E; B-cell receptor-associated protein 31; 6C6-AG tumor-associated antigen; BCR-associated protein Bap31; p28 Bap31; B cell receptor associated protein 31

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us