Creative Biolabs is offering the most comprehensive services for antibody development projects. With strict regulation and effective execution, we are dedicated to providing the most valuable solutions to complete your projects.
Creative Biolabs is offering the most comprehensive services for antibody development projects. With strict regulation and effective execution, we are dedicated to providing the most valuable solutions to complete your projects.
Creative Biolabs is offering the most comprehensive services for antibody development projects. With strict regulation and effective execution, we are dedicated to providing the most valuable solutions to complete your projects.
Creative Biolabs is offering the most comprehensive services for antibody development projects. With strict regulation and effective execution, we are dedicated to providing the most valuable solutions to complete your projects.
With over a decade of experience in phage display technology, Creative Biolabs can provide a series of antibody or peptide libraries that are available for licensing or direct screening. These ready-to-use libraries are invaluable resources for isolating target-specific binders for various research, diagnostic or therapeutic applications.
Creative Biolabs has established a broad range of platforms for developing novel antibodies or equivalents. These cutting-edge technologies enable our scientists to meet your demands from different aspects and tailor the most appropriate solution that contributes to the success of your projects.
With deep understanding in antibody-related realms and extensive project experience, Creative Biolabs offers a variety of references to help you learn more about our capacities and achievements, including infographic, flyer, case study, peer-reviewed publications, and all kinds of knowledge that can assist your projects. You are also welcome to contact us directly for more specific solutions.
Get a real taste of Creative Biolabs, one of the most professional custom service providers in the world. We are committed to providing highly customized comprehensive solutions with the best quality to advance your projects.
Magic™ Membrane Protein Human BMPR1A (Bone morphogenetic protein receptor type 1A) Expressed in NS0 for Antibody Discovery, Partial (1-152aa)
"Creative Biolabs is committed to providing highly customized comprehensive solutions with the best quality to advance our global clients’ projects."
Magic™ Membrane Protein Human BMPR1A (Bone morphogenetic protein receptor type 1A) Expressed in NS0 for Antibody Discovery, Partial (1-152aa) (CAT#: MPX0225K)
This product is a 40.8 kDa Human BMPR1A membrane protein expressed in NS0. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.
Product Specifications
Host Species
Human
Target Protein
BMPR1A
Protein Length
Partial (1-152aa)
Protein Class
Transferase
Molecular Weight
40.8 kDa
TMD
1
Sequence
MPQLYIYIRLLGAYLFIISRVQGQNLDSMLHGTGMKSDSDQKKSENGVTL APEDTLPFLKCYCSGHCPDDAINNTCITNGHCFAIIEEDDQGETTLASGC MKYEGSDFQCKDSPKAQLRRTIECCRTNLCNQYLQPTLPPVVIGPFFDGS IR
Product Description
Expression Systems
NS0
Tag
hIgG1 Fc tag at the C-terminus
Protein Format
Soluble
Reconstitution
Reconstitute at 100 μg/mL in PBS.
Endotoxin
<0.01 EU per 1 μg of the protein by the LAL method.
Purity
>95%, by SDS-PAGE visualized with Silver Staining and quantitative densitometry by Coomassie® Blue Staining.
Buffer
Lyophilized from a 0.2 μm filtered solution in PBS.
Target
Target Protein
BMPR1A
Full Name
Bone morphogenetic protein receptor type 1A
Introduction
The bone morphogenetic protein (BMP) receptors are a family of transmembrane serine/threonine kinases that include the type I receptors BMPR1A and BMPR1B and the type II receptor BMPR2. These receptors are also closely related to the activin receptors, ACVR1 and ACVR2. The ligands of these receptors are members of the TGF-beta superfamily. TGF-betas and activins transduce their signals through the formation of heteromeric complexes with 2 different types of serine (threonine) kinase receptors: type I receptors of about 50-55 kD and type II receptors of about 70-80 kD. Type II receptors bind ligands in the absence of type I receptors, but they require their respective type I receptors for signaling, whereas type I receptors require their respective type II receptors for ligand binding.
Alternative Names
BMPR1A; ALK3; SKR5; CD292; ACVRLK3; 10q23del; bone morphogenetic protein receptor type-1A; ALK-3; BMP type-1A receptor; BMPR-1A; activin A receptor, type II-like kinase 3; activin receptor-like kinase 3; bone morphogenetic protein receptor, type IA; serine/threonine-protein kinase receptor R5; Bone morphogenetic protein receptor type 1A