Close

Magic™ Membrane Protein Human BMPR1A (Bone morphogenetic protein receptor type 1A) Expressed in NS0 for Antibody Discovery, Partial (1-152aa) (CAT#: MPX0225K)

This product is a 40.8 kDa Human BMPR1A membrane protein expressed in NS0. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • BMPR1A
  • Protein Length
  • Partial (1-152aa)
  • Protein Class
  • Transferase
  • Molecular Weight
  • 40.8 kDa
  • TMD
  • 1
  • Sequence
  • MPQLYIYIRLLGAYLFIISRVQGQNLDSMLHGTGMKSDSDQKKSENGVTL
    APEDTLPFLKCYCSGHCPDDAINNTCITNGHCFAIIEEDDQGETTLASGC
    MKYEGSDFQCKDSPKAQLRRTIECCRTNLCNQYLQPTLPPVVIGPFFDGS
    IR

Product Description

  • Expression Systems
  • NS0
  • Tag
  • hIgG1 Fc tag at the C-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 100 μg/mL in PBS.
  • Endotoxin
  • <0.01 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >95%, by SDS-PAGE visualized with Silver Staining and quantitative densitometry by Coomassie® Blue Staining.
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS.

Target

  • Target Protein
  • BMPR1A
  • Full Name
  • Bone morphogenetic protein receptor type 1A
  • Introduction
  • The bone morphogenetic protein (BMP) receptors are a family of transmembrane serine/threonine kinases that include the type I receptors BMPR1A and BMPR1B and the type II receptor BMPR2. These receptors are also closely related to the activin receptors, ACVR1 and ACVR2. The ligands of these receptors are members of the TGF-beta superfamily. TGF-betas and activins transduce their signals through the formation of heteromeric complexes with 2 different types of serine (threonine) kinase receptors: type I receptors of about 50-55 kD and type II receptors of about 70-80 kD. Type II receptors bind ligands in the absence of type I receptors, but they require their respective type I receptors for signaling, whereas type I receptors require their respective type II receptors for ligand binding.
  • Alternative Names
  • BMPR1A; ALK3; SKR5; CD292; ACVRLK3; 10q23del; bone morphogenetic protein receptor type-1A; ALK-3; BMP type-1A receptor; BMPR-1A; activin A receptor, type II-like kinase 3; activin receptor-like kinase 3; bone morphogenetic protein receptor, type IA; serine/threonine-protein kinase receptor R5; Bone morphogenetic protein receptor type 1A

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email: info@creative-biolabs.com
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2025 Creative Biolabs. | Contact Us