Close

Magic™ Membrane Protein Human BMPR2 (Bone morphogenetic protein receptor type 2) Expressed in NS0 for Antibody Discovery, Partial (26-151aa) (CAT#: MPX0223K)

This product is a 41.5 kDa Human BMPR2 membrane protein expressed in NS0. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • BMPR2
  • Protein Length
  • Partial (26-151aa)
  • Protein Class
  • Transferase
  • Molecular Weight
  • 41.5 kDa
  • TMD
  • 1
  • Sequence
  • ASQNQERLCAFKDPYQQDLGIGESR
    ISHENGTILCSKGSTCYGLWEKSKGDINLVKQGCWSHIGDPQECHYEECV
    VTTTPPSIQNGTYRFCCCSTDLCNVNFTENFPPPDTTPLSPPHSFNRDET
    I

Product Description

  • Expression Systems
  • NS0
  • Tag
  • hIgG1 Fc and 6xHis tag at the C-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 100 μg/mL in sterile PBS.
  • Endotoxin
  • <0.10 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >97%, by SDS-PAGE under reducing conditions and visualized by silver stain
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS.

Target

  • Target Protein
  • BMPR2
  • Full Name
  • Bone morphogenetic protein receptor type 2
  • Introduction
  • This gene encodes a member of the bone morphogenetic protein (BMP) receptor family of transmembrane serine/threonine kinases. The ligands of this receptor are members of the TGF-beta superfamily. BMPs are involved in endochondral bone formation and embryogenesis. These proteins transduce their signals through the formation of heteromeric complexes of two different types of serine (threonine) kinase receptors: type I receptors of about 50-55 kD and type II receptors of about 70-80 kD. Mutations in this gene have been associated with primary pulmonary hypertension, both familial and fenfluramine-associated, and with pulmonary venoocclusive disease.
  • Alternative Names
  • BMPR2; BMR2; PPH1; BMPR3; BRK-3; POVD1; T-ALK; BMPR-II; bone morphogenetic protein receptor type-2; BMP type II receptor; BMP type-2 receptor; bone morphogenetic protein receptor type II; bone morphogenetic protein receptor, type II (serine/threonine kinase); type II activin receptor-like kinase; type II receptor for bone morphogenetic protein-4; Bone morphogenetic protein receptor type 2

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us