Close

Magic™ Membrane Protein Human CACNA2D1 (Calcium voltage-gated channel auxiliary subunit alpha2delta 1) Expressed in E.coli with 6xHis and SUMO tag at the N-terminus for Antibody Discovery, Partial (577-717aa) (CAT#: MPX4307K)

This product is a 32.3kDa Human CACNA2D1 membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CACNA2D1
  • Protein Length
  • Partial (577-717aa)
  • Protein Class
  • Transporter; Ion channel
  • Molecular Weight
  • 32.3kDa
  • TMD
  • 1
  • Sequence
  • KMIDGESGEKTFRTLVKSQDERYIDKGNRTYTWTPVNGTDYSLALVLPTYSFYYIKAKLEETITQARYSETLKPDNFEESGYTFIAPRDYCNDLKISDNNTEFLLNFNEFIDRKTPNNPSCNADLINRVLLDAGFTNELVQ

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • 6xHis and SUMO tag at the N-terminus
  • Protein Format
  • Soluble
  • Purity
  • >85% as determined by SDS-PAGE
  • Buffer
  • Tris-based buffer, 50% glycerol

Target

  • Target Protein
  • CACNA2D1
  • Full Name
  • Calcium voltage-gated channel auxiliary subunit alpha2delta 1
  • Introduction
  • The preproprotein encoded by this gene is cleaved into multiple chains that comprise the alpha-2 and delta subunits of the voltage-dependent calcium channel complex. Calcium channels mediate the influx of calcium ions into the cell upon membrane polarization. Mutations in this gene can cause cardiac deficiencies, including Brugada syndrome and short QT syndrome. Alternate splicing results in multiple transcript variants, some of which may lack the delta subunit portion.
  • Alternative Names
  • CACNA2; CCHL2A; CACNL2A; LINC01112; lncRNA-N3; voltage-dependent calcium channel subunit alpha-2/delta-1; calcium channel, L type, alpha 2 polypeptide; calcium channel, voltage-dependent, alpha 2/delta subunit 1; dihydropyridine-sensitive L-type, calcium channel alpha-2/delta subunit; voltage-gated calcium channel subunit alpha-2/delta-1; CACNA2D1; Calcium voltage-gated channel auxiliary subunit alpha2delta 1

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us