Close

Magic™ Membrane Protein Human CCR1 (C-C motif chemokine receptor 1) for Antibody Discovery (CAT#: MP1329J)

This product is a 41.2 kDa Human CCR1 membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CCR1
  • Protein Length
  • Full-length
  • Protein Class
  • GPCR
  • Molecular Weight
  • 41.2 kDa
  • TMD
  • 7
  • Sequence
  • METPNTTEDYDTTTEFDYGDATPCQKVNERAFGAQLLPPLYSLVFVIGLVGNILVVLVLV QYKRLKNMTSIYLLNLAISDLLFLFTLPFWIDYKLKDDWVFGDAMCKILSGFYYTGLYSE IFFIILLTIDRYLAIVHAVFALRARTVTFGVITSIIIWALAILASMPGLYFSKTQWEFTH HTCSLHFPHESLREWKLFQALKLNLFGLVLPLLVMIICYTGIIKILLRRPNEKKSKAVRL IFVIMIIFFLFWTPYNLTILISVFQDFLFTHECEQSRHLDLAVQVTEVIAYTHCCVNPVI YAFVGERFRKYLRQLFHRRVAVHLVKWLPFLSVDRLERVSSTSPSTGEHELSAGF

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • N-His or Tag-Free
  • Reconstitution
  • Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration).
  • Purity
  • >85% as determined by SDS-PAGE
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • CCR1
  • Full Name
  • C-C motif chemokine receptor 1
  • Introduction
  • This gene encodes a member of the beta chemokine receptor family, which is predicted to be a seven transmembrane protein similar to G protein-coupled receptors. The ligands of this receptor include macrophage inflammatory protein 1 alpha (MIP-1 alpha), regulated on activation normal T expressed and secreted protein (RANTES), monocyte chemoattractant protein 3 (MCP-3), and myeloid progenitor inhibitory factor-1 (MPIF-1). Chemokines and their receptors mediated signal transduction are critical for the recruitment of effector immune cells to the site of inflammation. Knockout studies of the mouse homolog suggested the roles of this gene in host protection from inflammatory response, and susceptibility to virus and parasite. This gene and other chemokine receptor genes, including CCR2, CCRL2, CCR3, CCR5 and CCXCR1, are found to form a gene cluster on chromosome 3p.
  • Alternative Names
  • C C chemokine receptor type 1; C C CKR 1; C-C chemokine receptor type 1; C-C CKR-1; CC CKR 1; CC-CKR-1; CCR 1; CCR-1; CCR1; CCR1_HUMAN; CD 191; CD191; CD191 antigen; Chemokine (C C motif) receptor 1; Chemokine C C motif receptor 1; CKR 1; CKR1; CMKBR 1; CMKBR1; CMKR 1; CMKR1; HM145; LD78 receptor; Macrophage inflammatory protein 1 alpha /Rantes receptor; Macrophage inflammatory protein 1 alpha receptor; Macrophage inflammatory protein 1-alpha receptor; Mip 1a R; MIP 1alpha R; MIP-1alpha-R; MIP1aR; RANTES R; RANTES receptor; RANTES-R; SCYAR1

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us