Close
Close

Magic™ Membrane Protein Human CCR8 (C-C motif chemokine receptor 8) Expressed in Yeast with 6xHis and Myc tag at the C-terminus for Antibody Discovery, Partial (1-35aa) (CAT#: MPX4210K)

Datasheet
This product is a 7.7 kDa Human CCR8 membrane protein expressed in Yeast. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CCR8
  • Protein Length
  • Partial (1-35aa)
  • Protein Class
  • GPCR
  • Molecular Weight
  • 7.7 kDa
  • TMD
  • 7
  • Sequence
  • MDYTLDLSVTTVTDYYYPDIFSSPCDAELIQTNGK

Product Description

  • Expression Systems
  • Yeast
  • Tag
  • 6xHis and Myc tag at the C-terminus
  • Protein Format
  • Soluble
  • Purity
  • >90% as determined by SDS-PAGE
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • CCR8
  • Full Name
  • C-C motif chemokine receptor 8
  • Introduction
  • This gene encodes a member of the beta chemokine receptor family, which is predicted to be a seven transmembrane protein similar to G protein-coupled receptors. Chemokines and their receptors are important for the migration of various cell types into the inflammatory sites. This receptor protein preferentially expresses in the thymus. I-309, thymus activation-regulated cytokine (TARC) and macrophage inflammatory protein-1 beta (MIP-1 beta) have been identified as ligands of this receptor. Studies of this receptor and its ligands suggested its role in regulation of monocyte chemotaxis and thymic cell apoptosis. More specifically, this receptor may contribute to the proper positioning of activated T cells within the antigenic challenge sites and specialized areas of lymphoid tissues. This gene is located at the chemokine receptor gene cluster region.
  • Alternative Names
  • CY6; TER1; CCR-8; CKRL1; CDw198; CMKBR8; GPRCY6; CMKBRL2; CC-CKR-8; C-C chemokine receptor type 8; CC chemokine receptor 8; CC chemokine receptor CHEMR1; CC-chemokine receptor chemr1; chemokine (C-C motif) receptor 8; chemokine (C-C) receptor 8; chemokine (C-C) receptor-like 2; chemokine receptor-like 1; CCR8; C-C motif chemokine receptor 8

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us