Close

Magic™ Membrane Protein Human CD47 (CD47 molecule) Expressed in CHO for Antibody Discovery, Partial (19-139aa) (CAT#: MPX0477K)

This product is a 42 kDa Human CD47 membrane protein expressed in CHO. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CD47
  • Protein Length
  • Partial (19-139aa)
  • Protein Class
  • Cell adhesion
  • Molecular Weight
  • 42 kDa
  • TMD
  • 5
  • Sequence
  • QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQN
    TTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKM
    DKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSP

Product Description

  • Activity
  • Yes
  • Expression Systems
  • CHO
  • Tag
  • hIgG1 Fc and Avi tag at the C-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 100 μg/mL in PBS.
  • Endotoxin
  • <0.10 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >95%, by SDS-PAGE visualized with Silver Staining and quantitative densitometry by Coomassie® Blue Staining.
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose.

Target

  • Target Protein
  • CD47
  • Full Name
  • CD47 molecule
  • Introduction
  • This gene encodes a membrane protein, which is involved in the increase in intracellular calcium concentration that occurs upon cell adhesion to extracellular matrix. The encoded protein is also a receptor for the C-terminal cell binding domain of thrombospondin, and it may play a role in membrane transport and signal transduction. This gene has broad tissue distribution, and is reduced in expression on Rh erythrocytes. Alternatively spliced transcript variants have been found for this gene.
  • Alternative Names
  • CD47; IAP; OA3; MER6; leukocyte surface antigen CD47; CD47 antigen (Rh-related antigen, integrin-associated signal transducer); CD47 glycoprotein; Rh-related antigen; antigen identified by monoclonal antibody 1D8; antigenic surface determinant protein OA3; integrin associated protein; integrin-associated signal transducer; CD47 molecule

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us