Close

Magic™ Membrane Protein Human CD70 (CD70 molecule) Expressed in Yeast with 6xHis tag at the N-terminus for Antibody Discovery, Partial (39-193aa) (CAT#: MPX4332K)

This product is a 19.1kDa Human CD70 membrane protein expressed in Yeast. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CD70
  • Protein Length
  • Partial (39-193aa)
  • Protein Class
  • Receptor
  • Molecular Weight
  • 19.1kDa
  • TMD
  • 1
  • Sequence
  • QRFAQAQQQLPLESLGWDVAELQLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP

Product Description

  • Expression Systems
  • Yeast
  • Tag
  • 6xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Purity
  • >90% as determined by SDS-PAGE
  • Buffer
  • Tris-based buffer, 50% glycerol

Target

  • Target Protein
  • CD70
  • Full Name
  • CD70 molecule
  • Introduction
  • The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for TNFRSF27/CD27. It is a surface antigen on activated, but not on resting, T and B lymphocytes. It induces proliferation of costimulated T cells, enhances the generation of cytolytic T cells, and contributes to T cell activation. This cytokine is also reported to play a role in regulating B-cell activation, cytotoxic function of natural killer cells, and immunoglobulin sythesis.
  • Alternative Names
  • CD70; CD27L; LPFS3; CD27-L; CD27LG; TNFSF7; TNLG8A; CD70 antigen; CD27 ligand; Ki-24 antigen; surface antigen CD70; tumor necrosis factor ligand 8A; tumor necrosis factor ligand superfamily member 7; CD70 molecule

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us