Close

Magic™ Membrane Protein Human CD81 (CD81 molecule) Expressed in E.coli with 6xHis and SUMO tag at the N-terminus for Antibody Discovery, Partial (113-201aa) (CAT#: MPX4492K)

This product is a 25.8kDa Human CD81 membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CD81
  • Protein Length
  • Partial (113-201aa)
  • Protein Class
  • Immunity; Receptor
  • Molecular Weight
  • 25.8kDa
  • TMD
  • 4
  • Sequence
  • FVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGK

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • 6xHis and SUMO tag at the N-terminus
  • Protein Format
  • Soluble
  • Purity
  • >90% as determined by SDS-PAGE
  • Buffer
  • Tris-based buffer, 50% glycerol

Target

  • Target Protein
  • CD81
  • Full Name
  • CD81 molecule
  • Introduction
  • The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein that is known to complex with integrins. This protein appears to promote muscle cell fusion and support myotube maintenance. Also it may be involved in signal transduction. This gene is localized in the tumor-suppressor gene region and thus it is a candidate gene for malignancies. Two transcript variants encoding different isoforms have been found for this gene.
  • Alternative Names
  • CD81; S5.7; CVID6; TAPA1; TSPAN28; CD81 antigen; 26 kDa cell surface protein TAPA-1; CD81 antigen (target of antiproliferative antibody 1); tetraspanin-28; tspan-28; CD81 molecule

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us