Close
Close

Magic™ Membrane Protein Human CD8A (CD8a molecule) Expressed in Mammalian cell expression system with 6xHis tag at the N-terminus for Antibody Discovery, Partial (22-182aa) (CAT#: MPX4607K)

Datasheet
This product is a 21.6kDa Human CD8A membrane protein expressed in Mammalian cell expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CD8A
  • Protein Length
  • Partial (22-182aa)
  • Protein Class
  • Immunity
  • Molecular Weight
  • 21.6kDa
  • TMD
  • 1
  • Sequence
  • SQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD

Product Description

  • Expression Systems
  • Mammalian cell expression system
  • Tag
  • 6xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Purity
  • >90% as determined by SDS-PAGE
  • Buffer
  • Tris-based buffer, 50% glycerol

Target

  • Target Protein
  • CD8A
  • Full Name
  • CD8a molecule
  • Introduction
  • The CD8 antigen is a cell surface glycoprotein found on most cytotoxic T lymphocytes that mediates efficient cell-cell interactions within the immune system. The CD8 antigen acts as a coreceptor with the T-cell receptor on the T lymphocyte to recognize antigens displayed by an antigen presenting cell in the context of class I MHC molecules. The coreceptor functions as either a homodimer composed of two alpha chains or as a heterodimer composed of one alpha and one beta chain. Both alpha and beta chains share significant homology to immunoglobulin variable light chains. This gene encodes the CD8 alpha chain. Multiple transcript variants encoding different isoforms have been found for this gene. The major protein isoforms of this gene differ by the presence or absence of a transmembrane domain and thus differ in being a membrane-anchored or secreted protein.
  • Alternative Names
  • CD8A; CD8; p32; Leu2; T-cell surface glycoprotein CD8 alpha chain; CD8 antigen, alpha polypeptide (p32); Leu2 T-lymphocyte antigen; OKT8 T-cell antigen; T cell co-receptor; T-cell antigen Leu2; T-lymphocyte differentiation antigen T8/Leu-2; T8 T-cell antigen; CD8a molecule

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us