Close

Magic™ Membrane Protein Human CEMIP2 (Cell migration inducing hyaluronidase 2) Expressed in E.coli with 10xHis tag at the N-terminus for Antibody Discovery, Partial (104-250aa) (CAT#: MPX4669K)

This product is a 21.5 kDa Human CEMIP2 membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CEMIP2
  • Protein Length
  • Partial (104-250aa)
  • Protein Class
  • Transporter
  • Molecular Weight
  • 21.5 kDa
  • TMD
  • 1
  • Sequence
  • SSKYAPDENCPDQNPRLRNWDPGQDSAKQVVIKEGDMLRLTSDATVHSIVIQDGGLLVFGDNKDGSRNITLRTHYILIQDGGALHIGAEKCRYKSKATITLYGKSDEGESMPTFGKKFIGVEAGGTLELHGARKASWTLLARTLNSS

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • 10xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Purity
  • >85% as determined by SDS-PAGE
  • Buffer
  • Tris-based buffer, 50% glycerol

Target

  • Target Protein
  • CEMIP2
  • Full Name
  • Cell migration inducing hyaluronidase 2
  • Introduction
  • This gene encodes a type II transmembrane protein that belongs to the interferon-induced transmembrane (IFITM) protein superfamily. The encoded protein functions as a cell surface hyaluronidase that cleaves extracellular high molecular weight hyaluronan into intermediate size fragments before internalization and degradation in the lysosome. It also has an interferon-mediated antiviral function in humans through activation of the JAK STAT signaling pathway. The activation of this gene by transcription factor SOX4 in breast cancer cells has been shown to mediate the pathological effects of SOX4 on cancer progression. Naturally occurring mutations in this gene are associated with autosomal recessive non-syndromic hearing loss.
  • Alternative Names
  • CEMIP2; TMEM2; cell surface hyaluronidase; transmembrane protein 2; Cell migration inducing hyaluronidase 2

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us