Close

Magic™ Membrane Protein Human CHRM3 (Cholinergic receptor muscarinic 3) Expressed in E.coli with 6xHis and B2M tag at the N-terminus for Antibody Discovery, Partial (253-492aa) (CAT#: MPX4617K)

This product is a 40.7kDa Human CHRM3 membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CHRM3
  • Protein Length
  • Partial (253-492aa)
  • Protein Class
  • GPCR
  • Molecular Weight
  • 40.7kDa
  • TMD
  • 7
  • Sequence
  • RIYKETEKRTKELAGLQASGTEAETENFVHPTGSSRSCSSYELQQQSMKRSNRRKYGRCHFWFTTKSWKPSSEQMDQDHSSSDSWNNNDAAASLENSASSDEEDIGSETRAIYSIVLKLPGHSTILNSTKLPSSDNLQVPEEELGMVDLERKADKLQAQKSVDDGGSFPKSFSKLPIQLESAVDTAKTSDVNSSVGKSTATLPLSFKEATLAKRFALKTRSQITKRKRMSLVKEKKAAQT

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • 6xHis and B2M tag at the N-terminus
  • Protein Format
  • Soluble
  • Purity
  • >90% as determined by SDS-PAGE
  • Buffer
  • Tris-based buffer, 50% glycerol

Target

  • Target Protein
  • CHRM3
  • Full Name
  • Cholinergic receptor muscarinic 3
  • Introduction
  • The muscarinic cholinergic receptors belong to a larger family of G protein-coupled receptors. The functional diversity of these receptors is defined by the binding of acetylcholine and includes cellular responses such as adenylate cyclase inhibition, phosphoinositide degeneration, and potassium channel mediation. Muscarinic receptors influence many effects of acetylcholine in the central and peripheral nervous system. The muscarinic cholinergic receptor 3 controls smooth muscle contraction and its stimulation causes secretion of glandular tissue. Alternative promoter use and alternative splicing results in multiple transcript variants that have different tissue specificities.
  • Alternative Names
  • HM3; PBS; EGBRS; muscarinic acetylcholine receptor M3; acetylcholine receptor, muscarinic 3; m3 muscarinic receptor; CHRM3; Cholinergic receptor muscarinic 3

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us