Close

Magic™ Membrane Protein Human CHRNA1 (Cholinergic receptor nicotinic alpha 1 subunit) Expressed in E.coli with 6xHis and Trx tag at the N-terminus for Antibody Discovery, Partial (21-255aa) (CAT#: MPX4296K)

This product is a 44.1kDa Human CHRNA1 membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CHRNA1
  • Protein Length
  • Partial (21-255aa)
  • Protein Class
  • Transporter; Ion channel
  • Molecular Weight
  • 44.1kDa
  • TMD
  • 4
  • Sequence
  • SEHETRLVAKLFKDYSSVVRPVEDHRQVVEVTVGLQLIQLINVDEVNQIVTTNVRLKQGDMVDLPRPSCVTLGVPLFSHLQNEQWVDYNLKWNPDDYGGVKKIHIPSEKIWRPDLVLYNNADGDFAIVKFTKVLLQYTGHITWTPPAIFKSYCEIIVTHFPFDEQNCSMKLGTWTYDGSVVAINPESDQPDLSNFMESGEWVIKESRGWKHSVTYSCCPDTPYLDITYHFVMQRL

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • 6xHis and Trx tag at the N-terminus
  • Protein Format
  • Soluble
  • Purity
  • >90% as determined by SDS-PAGE
  • Buffer
  • Tris-based buffer, 50% glycerol

Target

  • Target Protein
  • CHRNA1
  • Full Name
  • Cholinergic receptor nicotinic alpha 1 subunit
  • Introduction
  • The muscle acetylcholine receptor consiststs of 5 subunits of 4 different types: 2 alpha subunits and 1 each of the beta, gamma, and delta subunits. This gene encodes an alpha subunit that plays a role in acetlycholine binding/channel gating. Alternatively spliced transcript variants encoding different isoforms have been identified.
  • Alternative Names
  • ACHRA; ACHRD; CHRNA; CMS1A; CMS1B; CMS2A; FCCMS; SCCMS; acetylcholine receptor subunit alpha; acetylcholine receptor, nicotinic, alpha 1 (muscle); cholinergic receptor, nicotinic alpha 1; cholinergic receptor, nicotinic, alpha 1 (muscle); cholinergic receptor, nicotinic, alpha polypeptide 1 (muscle); muscle nicotinic acetylcholine receptor; nicotinic acetylcholine receptor alpha subunit; nicotinic cholinergic receptor alpha 1; CHRNA1; Cholinergic receptor nicotinic alpha 1 subunit

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us