Close

Magic™ Membrane Protein Human CLDN18 (Claudin 18) Expressed in E.coli with GST tag at the N-terminus for Antibody Discovery, Partial (28-80aa) (CAT#: MPX4202K)

This product is a 32.8 kDa Human CLDN18 membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CLDN18
  • Protein Length
  • Partial (28-80aa)
  • Protein Class
  • Receptor
  • Molecular Weight
  • 32.8 kDa
  • TMD
  • 4
  • Sequence
  • DQWSTQDLYNNPVTAVFNYQGLWRSCVRESSGFTECRGYFTLLGLPAMLQAVR

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • GST tag at the N-terminus
  • Protein Format
  • Soluble
  • Purity
  • >85% as determined by SDS-PAGE.
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • CLDN18
  • Full Name
  • Claudin 18
  • Introduction
  • This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining cell polarity and signal transductions. This gene is upregulated in patients with ulcerative colitis and highly overexpressed in infiltrating ductal adenocarcinomas. PKC/MAPK/AP-1 (protein kinase C/mitogen-activated protein kinase/activator protein-1) dependent pathway regulates the expression of this gene in gastric cells. Alternatively spliced transcript variants encoding different isoforms have been identified.
  • Alternative Names
  • CLDN18; SFTA5; SFTPJ; claudin-18; surfactant associated 5; surfactant associated protein J; surfactant, pulmonary associated protein J; Claudin 18

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us