Close

Magic™ Membrane Protein Human CLEC4G (C-type lectin domain family 4 member G) Expressed in NS0 for Antibody Discovery, Partial (54-293aa) (CAT#: MPX0550K)

This product is a 27.8 kDa Human CLEC4G membrane protein expressed in NS0. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CLEC4G
  • Protein Length
  • Partial (54-293aa)
  • Protein Class
  • Receptor
  • Molecular Weight
  • 27.8 kDa
  • TMD
  • 1
  • Sequence
  • SKASTER
    AALLDGHDLLRTNASKQTAALGALKEEVGDCHSCCSGTQAQLQTTRAELGEAQAKLMEQE
    SALRELRERVTQGLAEAGRGREDVRTELFRALEAVRLQNNSCEPCPTSWLSFEGSCYFFS
    VPKTTWAAAQDHCADASAHLVIVGGLDEQGFLTRNTRGRGYWLGLRAVRHLGKVQGYQWV
    DGVSLSFSHWNQGEPNDAWGRENCVMMLHTGLWNDAPCDSEKDGWICEKRHNC

Product Description

  • Activity
  • Yes
  • Expression Systems
  • NS0
  • Tag
  • 9xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 100 μg/mL in sterile PBS.
  • Endotoxin
  • <0.10 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >90%, by SDS-PAGE under reducing conditions and visualized by silver stain.
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in Tris-Citrate and NaCl.

Target

  • Target Protein
  • CLEC4G
  • Full Name
  • C-type lectin domain family 4 member G
  • Introduction
  • This gene encodes a glycan-binding receptor and member of the C-type lectin family which plays a role in the immune response. C-type lectin receptors are pattern recognition receptors located on immune cells that play a role in the recognition and uptake of both self and non-self glycoproteins as well as mediating cell adhesion, glycoprotein clearance, and cell signaling functions. This gene's protein binds complex-type N-glycans of the viral envelope proteins of Ebola virus, West Nile filovirus, and SARS coronavirus, but not HIV or hepatitis C virus. In mouse, this protein has been shown to recognize activated T-cells and to negatively regulate T-cell receptor-mediated signalling. It also acts as a novel, liver-specific regulator of NK cell-mediated immunity in mouse. Multiple transcript variants encoding different isoforms have been found for this gene.
  • Alternative Names
  • CLEC4G; LP2698; UNQ431; DTTR431; LSECtin; C-type lectin superfamily 4, member G; liver and lymph node sinusoidal endothelial cell C-type lectin; C-type lectin domain family 4 member G

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us