Close

Magic™ Membrane Protein Human CLEC7A (C-type lectin domain containing 7A) Expressed in NS0 for Antibody Discovery, Partial (66-201aa) (CAT#: MPX0617K)

This product is a 16.8 kDa Human CLEC7A membrane protein expressed in NS0. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CLEC7A
  • Protein Length
  • Partial (66-201aa)
  • Protein Class
  • Receptor; Immunity
  • Molecular Weight
  • 16.8 kDa
  • TMD
  • 1
  • Sequence
  • TMGVLSSPCPPNWIIYEKSCYLFSMSLNSWDGSKRQCWQLGSNLLKIDSSNELGF
    IVKQVSSQPDNSFWIGLSRPQTEVPWLWEDGSTFSSNLFQIRTTATQENPSPNCVWIHVS
    VIYDQLCSVPSYSICEKKFSM

Product Description

  • Activity
  • Yes
  • Expression Systems
  • NS0
  • Tag
  • 10xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 100 μg/mL in sterile PBS.
  • Endotoxin
  • <0.10 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >90%, by SDS-PAGE visualized with Silver Staining and quantitative densitometry by Coomassie® Blue Staining.
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS.

Target

  • Target Protein
  • CLEC7A
  • Full Name
  • C-type lectin domain containing 7A
  • Introduction
  • This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. The encoded glycoprotein is a small type II membrane receptor with an extracellular C-type lectin-like domain fold and a cytoplasmic domain with an immunoreceptor tyrosine-based activation motif. It functions as a pattern-recognition receptor that recognizes a variety of beta-1,3-linked and beta-1,6-linked glucans from fungi and plants, and in this way plays a role in innate immune response. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. This gene is closely linked to other CTL/CTLD superfamily members on chromosome 12p13 in the natural killer gene complex region.
  • Alternative Names
  • CLEC7A; BGR; CD369; CANDF4; SCARE2; DECTIN1; CLECSF12; C-type lectin domain family 7 member A; C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamily member 12; C-type lectin superfamily member 12; DC-associated C-type lectin 1; beta-glucan receptor; dectin-1; dendritic cell-associated C-type lectin-1; lectin-like receptor 1; C-type lectin domain containing 7A

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us