Close

Magic™ Membrane Protein Human COX6A2 (Cytochrome c oxidase subunit 6A2) Full Length (CAT#: MPC1279K) Made to Order

This product is a 10.8 kDa Human COX6A2 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • COX6A2
  • Protein Length
  • Full length
  • Protein Class
  • Transporter
  • Molecular Weight
  • 10.8 kDa
  • TMD
  • 1
  • Sequence
  • MALPLRPLTRGLASAAKGGHGGAGARTWRLLTFVLALPSVALCTFNSYLH
    SGHRPRPEFRPYQHLRIRTKPYPWGDGNHTLFHNSHVNPLPTGYEHP

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Flag-StrepII or based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • COX6A2
  • Full Name
  • Cytochrome c oxidase subunit 6A2
  • Introduction
  • Cytochrome c oxidase (COX), the terminal enzyme of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. It is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may be involved in the regulation and assembly of the complex. This nuclear gene encodes polypeptide 2 (heart/muscle isoform) of subunit VIa, and polypeptide 2 is present only in striated muscles. Polypeptide 1 (liver isoform) of subunit VIa is encoded by a different gene, and is found in all non-muscle tissues. These two polypeptides share 66% amino acid sequence identity.
  • Alternative Names
  • COX6A2; COX6AH; COXVIAH; MC4DN18; cytochrome c oxidase subunit 6A2, mitochondrial; COX VIa-M; cytochrome c oxidase polypeptide VIa-heart; cytochrome c oxidase subunit VIA-muscle; cytochrome c oxidase subunit VIa polypeptide 2; Cytochrome c oxidase subunit 6A2

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us