Close
Close

Magic™ Membrane Protein Human CR1 (Complement C3b/C4b receptor 1 (Knops blood group)) Expressed in E.coli with GST tag at the N-terminus for Antibody Discovery, Partial (41-234aa) (CAT#: MPX4643K)

Datasheet
This product is a 48.4kDa Human CR1 membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CR1
  • Protein Length
  • Partial (41-234aa)
  • Protein Class
  • Receptor; Immunity
  • Molecular Weight
  • 48.4kDa
  • TMD
  • 1
  • Sequence
  • GQCNAPEWLPFARPTNLTDEFEFPIGTYLNYECRPGYSGRPFSIICLKNSVWTGAKDRCRRKSCRNPPDPVNGMVHVIKGIQFGSQIKYSCTKGYRLIGSSSATCIISGDTVIWDNETPICDRIPCGLPPTITNGDFISTNRENFHYGSVVTYRCNPGSGGRKVFELVGEPSIYCTSNDDQVGIWSGPAPQCII

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • GST tag at the N-terminus
  • Protein Format
  • Soluble
  • Purity
  • >90% as determined by SDS-PAGE
  • Buffer
  • Tris-based buffer, 50% glycerol

Target

  • Target Protein
  • CR1
  • Full Name
  • Complement C3b/C4b receptor 1 (Knops blood group)
  • Introduction
  • This gene is a member of the receptors of complement activation (RCA) family and is located in the 'cluster RCA' region of chromosome 1. The genome is polymorphic at this locus with allele-specific splice variants encoding different isoforms, based on the presence/absence of long homologous repeats (LHRs). The gene encodes a monomeric single-pass type I membrane glycoprotein found on erythrocytes, leukocytes, glomerular podocytes, and splenic follicular dendritic cells. The Knops blood group system is a system of antigens located on this protein. The protein mediates cellular binding to particles and immune complexes that have activated complement. Decreases in expression of this protein and/or mutations in this gene have been associated with gallbladder carcinomas, mesangiocapillary glomerulonephritis, systemic lupus erythematosus, sarcoidosis and Alzheimer's disease. Mutations in this gene have also been associated with a reduction in Plasmodium falciparum rosetting, conferring protection against severe malaria.
  • Alternative Names
  • CR1; KN; C3BR; C4BR; CD35; complement receptor type 1; C3-binding protein; C3b/C4b receptor; CD35 antigen; Knops blood group antigen; complement component (3b/4b) receptor 1 (Knops blood group); complement receptor 1; Complement C3b/C4b receptor 1 (Knops blood group)

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us