Close
Close

Magic™ Membrane Protein Human CSF2RA (Colony stimulating factor 2 receptor subunit alpha) Expressed in E.coli with 6xHis and SUMO tag at the N-terminus for Antibody Discovery, Partial (23-320aa) (CAT#: MPX4563K)

Datasheet
This product is a 50.5kDa Human CSF2RA membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CSF2RA
  • Protein Length
  • Partial (23-320aa)
  • Protein Class
  • Receptor
  • Molecular Weight
  • 50.5kDa
  • TMD
  • 1
  • Sequence
  • EKSDLRTVAPASSLNVRFDSRTMNLSWDCQENTTFSKCFLTDKKNRVVEPRLSNNECSCTFREICLHEGVTFEVHVNTSQRGFQQKLLYPNSGREGTAAQNFSCFIYNADLMNCTWARGPTAPRDVQYFLYIRNSKRRREIRCPYYIQDSGTHVGCHLDNLSGLTSRNYFLVNGTSREIGIQFFDSLLDTKKIERFNPPSNVTVRCNTTHCLVRWKQPRTYQKLSYLDFQYQLDVHRKNTQPGTENLLINVSGDLENRYNFPSSEPRAKHSVKIRAADVRILNWSSWSEAIEFGSDDG

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • 6xHis and SUMO tag at the N-terminus
  • Protein Format
  • Soluble
  • Purity
  • >90% as determined by SDS-PAGE
  • Buffer
  • Tris-based buffer, 50% glycerol

Target

  • Target Protein
  • CSF2RA
  • Full Name
  • Colony stimulating factor 2 receptor subunit alpha
  • Introduction
  • The protein encoded by this gene is the alpha subunit of the heterodimeric receptor for colony stimulating factor 2, a cytokine which controls the production, differentiation, and function of granulocytes and macrophages. The encoded protein is a member of the cytokine family of receptors. This gene is found in the pseudoautosomal region (PAR) of the X and Y chromosomes. Multiple transcript variants encoding different isoforms have been found for this gene, with some of the isoforms being membrane-bound and others being soluble.
  • Alternative Names
  • CSF2RA; GMR; CD116; CSF2R; SMDP4; CDw116; CSF2RX; CSF2RY; GMCSFR; CSF2RAX; CSF2RAY; alphaGMR; GMR-alpha; GMCSFR-alpha; GM-CSF-R-alpha; granulocyte-macrophage colony-stimulating factor receptor subunit alpha; CD116 antigen; GM-CSF receptor alpha subunit; alpha-GM-CSF receptor; colony stimulating factor 2 receptor alpha subunit; colony stimulating factor 2 receptor, alpha, low-affinity (granulocyte-macrophage); granulocyte-macrophage colony-stimulating factor receptor alpha chain; Colony stimulating factor 2 receptor subunit alpha

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us