Close

Magic™ Membrane Protein Human CTLA4 (Cytotoxic T-lymphocyte associated protein 4) expressed in CHO for Antibody Discovery (CAT#: MP0040Q)

This product is a 39.9 kDa Human CTLA4 membrane protein expressed in CHO. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CTLA4
  • Protein Length
  • Full-length
  • Protein Class
  • Druggable Genome, Transmembrane
  • Molecular Weight
  • 39.9 kDa
  • TMD
  • 1
  • Sequence
  • MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN

Product Description

  • Expression Systems
  • CHO
  • Tag
  • Fc chimera
  • Endotoxin
  • Less than 0.01 ng per µg protein
  • Purity
  • >95%, as determined by Coomassie stained SDS-PAGE
  • Buffer
  • 1 x PBS

Target

  • Target Protein
  • CTLA4
  • Full Name
  • Cytotoxic T-lymphocyte associated protein 4
  • Introduction
  • This gene is a member of the immunoglobulin superfamily and encodes a protein which transmits an inhibitory signal to T cells. The protein contains a V domain, a transmembrane domain, and a cytoplasmic tail. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. The membrane-bound isoform functions as a homodimer interconnected by a disulfide bond, while the soluble isoform functions as a monomer. Mutations in this gene have been associated with insulin-dependent diabetes mellitus, Graves disease, Hashimoto thyroiditis, celiac disease, systemic lupus erythematosus, thyroid-associated orbitopathy, and other autoimmune diseases.
  • Alternative Names
  • ALPS5; CD; CD152; CELIAC3; CTLA-4; GRD4; GSE; IDDM12; celiac disease 3; cytotoxic T lymphocyte associated antigen 4 short spliced form; cytotoxic T-lymphocyte-associated serine esterase-4; insulin-dependent diabetes mellitus 12; ligand and transmembrane spliced cytotoxic T lymphocyte associated antigen 4; Cytotoxic T-lymphocyte protein 4

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us