Close
Close

Magic™ Membrane Protein Human CXCR4 (C-X-C motif chemokine receptor 4) Expressed in E.coli with 10xHis and SUMO tag at the N-terminus, Myc tag at the C-terminus for Antibody Discovery, Partial (303-352aa) (CAT#: MPX4286K)

Datasheet
This product is a 25.2kDa Human CXCR4 membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CXCR4
  • Protein Length
  • Partial (303-352aa)
  • Protein Class
  • GPCR
  • Molecular Weight
  • 25.2kDa
  • TMD
  • 7
  • Sequence
  • PILYAFLGAKFKTSAQHALTSVSRGSSLKILSKGKRGGHSSVSTESESSS

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • 10xHis and SUMO tag at the N-terminus, Myc tag at the C-terminus
  • Protein Format
  • Soluble
  • Purity
  • >90% as determined by SDS-PAGE
  • Buffer
  • Tris-based buffer, 50% glycerol

Target

  • Target Protein
  • CXCR4
  • Full Name
  • C-X-C motif chemokine receptor 4
  • Introduction
  • This gene encodes a CXC chemokine receptor specific for stromal cell-derived factor-1. The protein has 7 transmembrane regions and is located on the cell surface. It acts with the CD4 protein to support HIV entry into cells and is also highly expressed in breast cancer cells. Mutations in this gene have been associated with WHIM (warts, hypogammaglobulinemia, infections, and myelokathexis) syndrome. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
  • Alternative Names
  • FB22; HM89; LAP3; LCR1; NPYR; WHIM; CD184; LAP-3; LESTR; NPY3R; NPYRL; WHIMS; HSY3RR; NPYY3R; D2S201E; C-X-C chemokine receptor type 4; CD184 antigen; LPS-associated protein 3
    SDF-1 receptor; chemokine (C-X-C motif) receptor 4; fusin; leukocyte-derived seven transmembrane domain receptor; lipopolysaccharide-associated protein 3; neuropeptide Y receptor Y3
    neuropeptide Y3 receptor; seven transmembrane helix receptor; seven-transmembrane-segment receptor, spleen; stromal cell-derived factor 1 receptor; CXCR4; C-X-C motif chemokine receptor 4

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us