Close

Magic™ Membrane Protein Human EGF (Epidermal growth factor) Expressed in E.coli with GST tag at the N-terminus for Antibody Discovery, Partial (977-1023aa) (CAT#: MPX4432K)

This product is a 32.6kDa Human EGF membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • EGF
  • Protein Length
  • Partial (977-1023aa)
  • Protein Class
  • Growth factor
  • Molecular Weight
  • 32.6kDa
  • TMD
  • 1
  • Sequence
  • PLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • GST tag at the N-terminus
  • Protein Format
  • Soluble
  • Purity
  • >90% as determined by SDS-PAGE
  • Buffer
  • Tris-based buffer, 50% glycerol

Target

  • Target Protein
  • EGF
  • Full Name
  • Epidermal growth factor
  • Introduction
  • This gene encodes a member of the epidermal growth factor superfamily. The encoded preproprotein is proteolytically processed to generate the 53-amino acid epidermal growth factor peptide. This protein acts a potent mitogenic factor that plays an important role in the growth, proliferation and differentiation of numerous cell types. This protein acts by binding with high affinity to the cell surface receptor, epidermal growth factor receptor. Defects in this gene are the cause of hypomagnesemia type 4. Dysregulation of this gene has been associated with the growth and progression of certain cancers. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed.
  • Alternative Names
  • EGF; URG; HOMG4; pro-epidermal growth factor; beta-urogastrone; Urogastrone; Epidermal growth factor

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us