Close

Magic™ Membrane Protein Human FAS (Fas cell surface death receptor) Expressed in E.coli with Tag-Free for Antibody Discovery, Partial (17-173aa) (CAT#: MPX4081K)

This product is a 17.6 kDa Human FAS membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • FAS
  • Protein Length
  • Partial (17-173aa)
  • Protein Class
  • Receptor
  • Molecular Weight
  • 17.6 kDa
  • TMD
  • 1
  • Sequence
  • RLSSKSVNAQVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHFSSKCRRCRLCDEGHGLEVEINCTRTQNTKCRCKPNFFCNSTVCEHCDPCTKCEHGIIKECTLTSNTKCKEEGSRSN

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • Tag-Free
  • Protein Format
  • Soluble
  • Purity
  • >95% as determined by SDS-PAGE and HPLC
  • Buffer
  • 0.2 μm filtered PBS, pH 7.4

Target

  • Target Protein
  • FAS
  • Full Name
  • Fas cell surface death receptor
  • Introduction
  • The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor contains a death domain. It has been shown to play a central role in the physiological regulation of programmed cell death, and has been implicated in the pathogenesis of various malignancies and diseases of the immune system. The interaction of this receptor with its ligand allows the formation of a death-inducing signaling complex that includes Fas-associated death domain protein (FADD), caspase 8, and caspase 10. The autoproteolytic processing of the caspases in the complex triggers a downstream caspase cascade, and leads to apoptosis. This receptor has been also shown to activate NF-kappaB, MAPK3/ERK1, and MAPK8/JNK, and is found to be involved in transducing the proliferating signals in normal diploid fibroblast and T cells. Several alternatively spliced transcript variants have been described, some of which are candidates for nonsense-mediated mRNA decay (NMD). The isoforms lacking the transmembrane domain may negatively regulate the apoptosis mediated by the full length isoform.
  • Alternative Names
  • FAS; APT1; CD95; FAS1; APO-1; FASTM; ALPS1A; TNFRSF6; tumor necrosis factor receptor superfamily member 6; APO-1 cell surface antigen; CD95 antigen; FASLG receptor; Fas (TNF receptor superfamily, member 6); Fas AMA; TNF receptor superfamily member 6; apoptosis antigen 1; apoptosis signaling receptor FAS; apoptosis-mediating surface antigen FAS; mutant tumor necrosis receptor superfamily member 6; tumor necrosis factor receptor superfamily, member 6; Fas cell surface death receptor

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us