Close

Magic™ Membrane Protein Human FCER1A (Fc fragment of IgE receptor Ia) Expressed in Yeast with 6xHis tag at the N-terminus for Antibody Discovery, Partial (26-205aa) (CAT#: MPX4325K)

This product is a 23.0kDa Human FCER1A membrane protein expressed in Yeast. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • FCER1A
  • Protein Length
  • Partial (26-205aa)
  • Protein Class
  • Receptor
  • Molecular Weight
  • 23.0kDa
  • TMD
  • 1
  • Sequence
  • VPQKPKVSLNPPWNRIFKGENVTLTCNGNNFFEVSSTKWFHNGSLSEETNSSLNIVNAKFEDSGEYKCQHQQVNESEPVYLEVFSDWLLLQASAEVVMEGQPLFLRCHGWRNWDVYKVIYYKDGEALKYWYENHNISITNATVEDSGTYYCTGKVWQLDYESEPLNITVIKAPREKYWLQ

Product Description

  • Expression Systems
  • Yeast
  • Tag
  • 6xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Purity
  • >90% as determined by SDS-PAGE
  • Buffer
  • Tris-based buffer, 50% glycerol

Target

  • Target Protein
  • FCER1A
  • Full Name
  • Fc fragment of IgE receptor Ia
  • Introduction
  • The immunoglobulin epsilon receptor (IgE receptor) is the initiator of the allergic response. When two or more high-affinity IgE receptors are brought together by allergen-bound IgE molecules, mediators such as histamine that are responsible for allergy symptoms are released. This receptor is comprised of an alpha subunit, a beta subunit, and two gamma subunits. The protein encoded by this gene represents the alpha subunit.
  • Alternative Names
  • FCER1A; FCE1A; FcERI; high affinity immunoglobulin epsilon receptor subunit alpha; Fc IgE receptor, alpha polypeptide; Fc epsilon RI alpha-chain; Fc epsilon receptor Ia; Fc fragment of IgE, high affinity I, receptor for; alpha polypeptide; Fc-epsilon RI-alpha; high affinity immunoglobulin epsilon receptor alpha-subunit; igE Fc receptor subunit alpha; immunoglobulin E receptor, high-affinity, of mast cells, alpha polypeptide; Fc fragment of IgE receptor Ia

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us