Close

Magic™ Membrane Protein Human FCER2 (Fc fragment of IgE receptor II) Expressed in E.coli with 6xHis and SUMO tag at the N-terminus for Antibody Discovery, Partial (48-321aa) (CAT#: MPX4561K)

This product is a 47.0kDa Human FCER2 membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • FCER2
  • Protein Length
  • Partial (48-321aa)
  • Protein Class
  • Receptor
  • Molecular Weight
  • 47.0kDa
  • TMD
  • 1
  • Sequence
  • DTTQSLKQLEERAARNVSQVSKNLESHHGDQMAQKSQSTQISQELEELRAEQQRLKSQDLELSWNLNGLQADLSSFKSQELNERNEASDLLERLREEVTKLRMELQVSSGFVCNTCPEKWINFQRKCYYFGKGTKQWVHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGSWIGLRNLDLKGEFIWVDGSHVDYSNWAPGEPTSRSQGEDCVMMRGSGRWNDAFCDRKLGAWVCDRLATCTPPASEGSAESMGPDSRPDPDGRLPTPSAPLHS

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • 6xHis and SUMO tag at the N-terminus
  • Protein Format
  • Soluble
  • Purity
  • >90% as determined by SDS-PAGE
  • Buffer
  • Tris-based buffer, 50% glycerol

Target

  • Target Protein
  • FCER2
  • Full Name
  • Fc fragment of IgE receptor II
  • Introduction
  • The protein encoded by this gene is a B-cell specific antigen, and a low-affinity receptor for IgE. It has essential roles in B cell growth and differentiation, and the regulation of IgE production. This protein also exists as a soluble secreted form, then functioning as a potent mitogenic growth factor. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.
  • Alternative Names
  • FCER2; CD23; FCE2; CD23A; IGEBF; CLEC4J; BLAST-2; low affinity immunoglobulin epsilon Fc receptor; C-type lectin domain family 4, member J; CD23 antigen; Fc epsilon receptor II; Fc fragment of IgE, low affinity II, receptor for (CD23); fc-epsilon-RII; immunoglobulin E-binding factor; immunoglobulin epsilon-chain; lymphocyte IgE receptor; Fc fragment of IgE receptor II

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us