Close

Magic™ Membrane Protein Human FCGR2C (Fc fragment of IgG receptor IIc (gene/pseudogene)) Expressed in vitro E.coli expression system, Full Length of Mature Protein (CAT#: MPX3794K)

This product is a Human FCGR2C membrane protein expressed in vitro E.coli expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • FCGR2C
  • Protein Length
  • Full Length of Mature Protein
  • Protein Class
  • Receptor
  • TMD
  • 1
  • Sequence
  • TPAAPPKAVLKLEPQWINVLQEDSVTLTCRGTHSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIVLRCHSWKDKPLVKVTFFQNGKSKKFSRSDPNFSIPQANHSHSGDYHCTGNIGYTLYSSKPVTITVQAPSSSPMGIIVAVVTGIAVAAIVAAVVALIYCRKKRISANSTDPVKAAQFEPPGRQMIAIRKRQPEETNNDYETADGGYMTLNPRAPTDDDKNIYLTLPPNDHVNSNN

Product Description

  • Expression Systems
  • in vitro E.coli expression system
  • Tag
  • 10xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • FCGR2C
  • Full Name
  • Fc fragment of IgG receptor IIc (gene/pseudogene)
  • Introduction
  • This gene encodes one of three members of a family of low-affinity immunoglobulin gamma Fc receptors found on the surface of many immune response cells. The encoded protein is a transmembrane glycoprotein and may be involved in phagocytosis and clearing of immune complexes. An allelic polymorphism in this gene results in both coding and non-coding variants.
  • Alternative Names
  • FCGR2C; CD32; FCG2; CD32C; CDW32; IGFR2; FCRIIC; low affinity immunoglobulin gamma Fc region receptor II-c; Fc fragment of IgG, low affinity IIc, receptor for (CD32); Fc gamma receptor IIC; IgG Fc receptor II-c; fc-gamma-RIIc; immunoglobulin G Fc receptor II-c; Fc fragment of IgG receptor IIc (gene/pseudogene)

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us