Close

Magic™ Membrane Protein Human GIPR (Gastric inhibitory polypeptide receptor) Expressed in E.coli with MBP tag at the N-terminus, 6xHis and Avi tag at the C-terminus for Antibody Discovery, Partial (22-138aa) (CAT#: MPX4160K)

This product is a 61.2 kDa Human GIPR membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • GIPR
  • Protein Length
  • Partial (22-138aa)
  • Protein Class
  • GPCR
  • Molecular Weight
  • 61.2 kDa
  • TMD
  • 7
  • Sequence
  • RAETGSKGQTAGELYQRWERYRRECQETLAAAEPPSGLACNGSFDMYVCWDYAAPNATARASCPWYLPWHHHVAAGFVLRQCGSDGQWGLWRDHTQCENPEKNEAFLDQRLILERLQ

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • MBP tag at the N-terminus, 6xHis and Avi tag at the C-terminus
  • Protein Format
  • Soluble
  • Purity
  • >85% as determined by SDS-PAGE.
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • GIPR
  • Full Name
  • Gastric inhibitory polypeptide receptor
  • Introduction
  • This gene encodes a G-protein coupled receptor for gastric inhibitory polypeptide (GIP), which was originally identified as an activity in gut extracts that inhibited gastric acid secretion and gastrin release, but subsequently was demonstrated to stimulate insulin release in the presence of elevated glucose. Mice lacking this gene exhibit higher blood glucose levels with impaired initial insulin response after oral glucose load. Defect in this gene thus may contribute to the pathogenesis of diabetes.
  • Alternative Names
  • PGQTL2; gastric inhibitory polypeptide receptor; GIP-R; glucose-dependent insulinotropic polypeptide receptor; GIPR; Gastric inhibitory polypeptide receptor

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us