Close

Magic™ Membrane Protein Human GJA1 (Gap junction protein alpha 1) Expressed in Mammalian cell expression system with 10xHis tag at the N-terminus for Antibody Discovery, Partial (233-382aa) (CAT#: MPX4188K)

This product is a 19.9 kDa Human GJA1 membrane protein expressed in Mammalian cell expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • GJA1
  • Protein Length
  • Partial (233-382aa)
  • Protein Class
  • Transporter
  • Molecular Weight
  • 19.9 kDa
  • TMD
  • 4
  • Sequence
  • FKGVKDRVKGKSDPYHATSGALSPAKDCGSQKYAYFNGCSSPTAPLSPMSPPGYKLVTGDRNNSSCRNYNKQASEQNWANYSAEQNRMGQAGSTISNSHAQPFDFPDDNQNSKKLAAGHELQPLAIVDQRPSSRASSRASSRPRPDDLEI

Product Description

  • Expression Systems
  • Mammalian cell expression system
  • Tag
  • 10xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Purity
  • >90% as determined by SDS-PAGE
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • GJA1
  • Full Name
  • Gap junction protein alpha 1
  • Introduction
  • This gene is a member of the connexin gene family. The encoded protein is a component of gap junctions, which are composed of arrays of intercellular channels that provide a route for the diffusion of low molecular weight materials from cell to cell. The encoded protein is the major protein of gap junctions in the heart that are thought to have a crucial role in the synchronized contraction of the heart and in embryonic development. A related intronless pseudogene has been mapped to chromosome 5. Mutations in this gene have been associated with oculodentodigital dysplasia, autosomal recessive craniometaphyseal dysplasia and heart malformations.
  • Alternative Names
  • HSS; CMDR; CX43; EKVP; GJAL; ODDD; AVSD3; EKVP3; HLHS1; PPKCA; connexin-43; gap junction 43 kDa heart protein; gap junction protein, alpha 1, 43kDa; gap junction alpha-1 protein; GJA1; Gap junction protein alpha 1

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us