Close

Magic™ Membrane Protein Human GLIPR1 (GLI pathogenesis related 1) Expressed in vitro E.coli expression system, Full Length of Mature Protein (CAT#: MPX1471K)

This product is a Human GLIPR1 membrane protein expressed in vitro E.coli expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • GLIPR1
  • Protein Length
  • Full Length of Mature Protein
  • Protein Class
  • Receptor
  • TMD
  • 1
  • Sequence
  • ANILPDIENEDFIKDCVRIHNKFRSEVKPTASDMLYMTWDPALAQIAKAWASNCQFSHNTRLKPPHKLHPNFTSLGENIWTGSVPIFSVSSAITNWYDEIQDYDFKTRICKKVCGHYTQVVWADSYKVGCAVQFCPKVSGFDALSNGAHFICNYGPGGNYPTWPYKRGATCSACPNNDKCLDNLCVNRQRDQVKRYYSVVYPGWPIYPRNRYTSLFLIVNSVILILSVIITILVQHKYPNLVLLD

Product Description

  • Expression Systems
  • in vitro E.coli expression system
  • Tag
  • 10xHis and SUMO tag
  • Protein Format
  • Soluble
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • GLIPR1
  • Full Name
  • GLI pathogenesis related 1
  • Introduction
  • This gene encodes a protein with similarity to both the pathogenesis-related protein (PR) superfamily and the cysteine-rich secretory protein (CRISP) family. Increased expression of this gene is associated with myelomocytic differentiation in macrophage and decreased expression of this gene through gene methylation is associated with prostate cancer. The protein has proapoptotic activities in prostate and bladder cancer cells. This gene is a member of a cluster on chromosome 12 containing two other similar genes. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized.
  • Alternative Names
  • GLIPR1; GLIPR; RTVP1; CRISP7; glioma pathogenesis-related protein 1; GLI pathogenesis-related 1 (glioma); gliPR 1; protein RTVP-1; related to testis-specific, vespid, and pathogenesis proteins 1; testes-specific vespid and pathogenesis protein 1; GLI pathogenesis related 1

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us