Close

Magic™ Membrane Protein Human GLP1R (Glucagon like peptide 1 receptor) Expressed in Mammalian cell expression system with 6xHis tag at the N-terminus for Antibody Discovery, Partial (24-145aa) (CAT#: MPX4616K)

This product is a 18.3kDa Human GLP1R membrane protein expressed in Mammalian cell expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • GLP1R
  • Protein Length
  • Partial (24-145aa)
  • Protein Class
  • GPCR
  • Molecular Weight
  • 18.3kDa
  • TMD
  • 7
  • Sequence
  • RPQGATVSLWETVQKWREYRRQCQRSLTEDPPPATDLFCNRTFDEYACWPDGEPGSFVNVSCPWYLPWASSVPQGHVYRFCTAEGLWLQKDNSSLPWRDLSECEESKRGERSSPEEQLLFLY

Product Description

  • Expression Systems
  • Mammalian cell expression system
  • Tag
  • 6xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Purity
  • >90% as determined by SDS-PAGE
  • Buffer
  • Tris-based buffer, 50% glycerol

Target

  • Target Protein
  • GLP1R
  • Full Name
  • Glucagon like peptide 1 receptor
  • Introduction
  • This gene encodes a 7-transmembrane protein that functions as a receptor for glucagon-like peptide 1 (GLP-1) hormone, which stimulates glucose-induced insulin secretion. This receptor, which functions at the cell surface, becomes internalized in response to GLP-1 and GLP-1 analogs, and it plays an important role in the signaling cascades leading to insulin secretion. It also displays neuroprotective effects in animal models. Polymorphisms in this gene are associated with diabetes. The protein is an important drug target for the treatment of type 2 diabetes and stroke. Alternative splicing of this gene results in multiple transcript variants.
  • Alternative Names
  • GLP-1; GLP-1R; GLP-1-R; GLP-1 receptor; GLP1 receptor; seven transmembrane helix receptor; GLP1R; Glucagon like peptide 1 receptor

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us