Close
Close

Magic™ Membrane Protein Human GYPB (Glycophorin B (MNS blood group)) Expressed in vitro E.coli expression system, Full Length (CAT#: MPX0895K)

Datasheet
This product is a Human GYPB membrane protein expressed in vitro E.coli expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • GYPB
  • Protein Length
  • Full Length
  • Protein Class
  • Receptor
  • Molecular Weight
  • 10.5 kDa
  • TMD
  • 1
  • Sequence
  • LSTTEVAMHTSTSSSVTKSYISSQTNGETGQLVHRFTVPAPVVIILIILCVMAGIIGTILLISYSIRRLIKA

Product Description

  • Expression Systems
  • in vitro E.coli expression system
  • Tag
  • 10xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute protein in deionized sterile water
  • Purity
  • >85% as determined by SDS-PAGE.
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • GYPB
  • Full Name
  • Glycophorin B (MNS blood group)
  • Introduction
  • Glycophorins A (GYPA) and B (GYPB) are major sialoglycoproteins of the human erythrocyte membrane which bear the antigenic determinants for the MN and Ss blood groups. GYPB gene consists of 5 exons and has 97% sequence homology with GYPA from the 5' UTR to the coding sequence encoding the first 45 amino acids. In addition to the M or N and S or s antigens, that commonly occur in all populations, about 40 related variant phenotypes have been identified. These variants include all the variants of the Miltenberger complex and several isoforms of Sta; also, Dantu, Sat, He, Mg, and deletion variants Ena, S-s-U- and Mk. Most of the variants are the result of gene recombinations between GYPA and GYPB. Alternate splicing results in multiple transcript variants.
  • Alternative Names
  • GYPB; SS; GPB; GYP; MNS; GYPA; PAS-3; CD235b; glycophorin-B; GYPB-A fusion; GYPB-A-B fusion; GYPB/GYPA fusion; SS-active sialoglycoprotein; Ss blood group; blood group system MNSs, Mur-like; blood group system MNSs, St(a) type E; blood group system MNSs, St(a) type F; glycophorin A; glycophorin B blood group antigen; glycophorin B, blood group system Ss, S, Mit+; glycophorin B/glycophorin A fusion protein; glycophorin Hop; hybrid glycophorin Kip; sialoglycoprotein delta; Glycophorin B (MNS blood group)

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us