Close
Close

Magic™ Membrane Protein Human HLA-DQB1 (Major histocompatibility complex, class II, DQ beta 1) expressed in E.coli for Antibody Discovery (CAT#: MP1424J)

Datasheet
This product is a 27 kDa Human HLA-DQB1 membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • HLA-DQB1
  • Protein Length
  • Partial (33-227aa)
  • Protein Class
  • Human Leukocyte Antigen
  • Molecular Weight
  • 27 kDa
  • TMD
  • 1
  • Sequence
  • RDSPEDFVYQFKAMCYFTNGTERVRYVTRYIYNREEYARFDSDVEVYRAVTPLGPPDAEYWNSQKEVLERTRAELDTVCRHNYQLELRTTLQRRVEPTVTISPSRTEALNHHNLLVCSVTDFYPAQIKVRWFRNDQEETTGVVSTPLIRNGDWTFQILVMLEMTPQHGDVYTCHVEHPSLQNPITVEWRAQSESA

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • N-6xHis
  • Reconstitution
  • Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration).
  • Purity
  • >85% as determined by SDS-PAGE
  • Buffer
  • Liquid: Tris/PBS-based buffer, 5%-50% glycerol
    Lyophilized powder: Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • HLA-DQB1
  • Full Name
  • Major histocompatibility complex, class II, DQ beta 1
  • Introduction
  • HLA-DQB1 belongs to the HLA class II beta chain paralogs. This class II molecule is a heterodimer consisting of an alpha (DQA) and a beta chain (DQB), both anchored in the membrane. It plays a central role in the immune system by presenting peptides derived from extracellular proteins. Class II molecules are expressed in antigen presenting cells (APC: B lymphocytes, dendritic cells, macrophages). The beta chain is approximately 26-28 kDa and it contains six exons. Exon 1 encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, exon 4 encodes the transmembrane domain and exon 5 encodes the cytoplasmic tail. Within the DQ molecule both the alpha chain and the beta chain contain the polymorphisms specifying the peptide binding specificities, resulting in up to four different molecules. Typing for these polymorphisms is routinely done for bone marrow transplantation. Alternative splicing results in multiple transcript variants.
  • Alternative Names
  • CELIAC1; DQ beta 1 chain; DQB1_HUMAN; HLA class II histocompatibility antigen; HLA class II histocompatibility antigen; DQ beta 1 chain; HLA class II histocompatibility antigen; DQ beta 2 chain; HLA DQB; HLA DQB1; HLA-DQB1; HLA-DQB2; IDDM1; Lymphocyte antigen; Major histocompatibility complex class II beta; Major histocompatibility complex; class II; DQ beta 1; MHC class II antigen DQB1; MHC class II antigen HLA DQ beta 1; MHC class II DQ beta chain; MHC class II HLA DQ beta glycoprotein; MHC class2 antigen; MHC DQ beta; OTTHUMP00000029167; OTTHUMP00000178569; OTTHUMP00000178570; OTTHUMP00000178571

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us