Close

Magic™ Membrane Protein Human IGF1R (Insulin like growth factor 1 receptor) Expressed in Mammalian cell expression system with 10xHis tag at the N-terminus, Myc tag at the C-terminus for Antibody Discovery, Partial (763-931aa) (CAT#: MPX4674K)

This product is a 21.9 kDa Human IGF1R membrane protein expressed in Mammalian cell expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • IGF1R
  • Protein Length
  • Partial (763-931aa)
  • Protein Class
  • Transferase
  • Molecular Weight
  • 21.9 kDa
  • TMD
  • 1
  • Sequence
  • YNITDPEELETEYPFFESRVDNKERTVISNLRPFTLYRIDIHSCNHEAEKLGCSASNFVFARTMPAEGADDIPGPVTWEPRPENSIFLKWPEPENPNGLILMYEIKYGSQVEDQRECVSRQEYRKYGGAKLNRLNPGNYTARIQATSLSGNGSWTDPVFFYVQAKTGYE

Product Description

  • Expression Systems
  • Mammalian cell expression system
  • Tag
  • 10xHis tag at the N-terminus, Myc tag at the C-terminus
  • Protein Format
  • Soluble
  • Purity
  • >85% as determined by SDS-PAGE
  • Buffer
  • Tris-based buffer, 50% glycerol

Target

  • Target Protein
  • IGF1R
  • Full Name
  • Insulin like growth factor 1 receptor
  • Introduction
  • This receptor binds insulin-like growth factor with a high affinity. It has tyrosine kinase activity. The insulin-like growth factor I receptor plays a critical role in transformation events. Cleavage of the precursor generates alpha and beta subunits. It is highly overexpressed in most malignant tissues where it functions as an anti-apoptotic agent by enhancing cell survival. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
  • Alternative Names
  • IGF1R; IGFR; CD221; IGFIR; JTK13; insulin-like growth factor 1 receptor; IGF-I receptor; soluble IGF1R variant 1; soluble IGF1R variant 2; Insulin like growth factor 1 receptor

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us