Close

Magic™ Membrane Protein Human IL22RA1 (Interleukin 22 receptor subunit alpha 1) Expressed in E.coli with 6xHis and SUMO tag at the N-terminus for Antibody Discovery, Partial (250-573aa) (CAT#: MPX4508K)

This product is a 50.8kDa Human IL22RA1 membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • IL22RA1
  • Protein Length
  • Partial (250-573aa)
  • Protein Class
  • Receptor
  • Molecular Weight
  • 50.8kDa
  • TMD
  • 1
  • Sequence
  • SYRYVTKPPAPPNSLNVQRVLTFQPLRFIQEHVLIPVFDLSGPSSLAQPVQYSQIRVSGPREPAGAPQRHSLSEITYLGQPDISILQPSNVPPPQILSPLSYAPNAAPEVGPPSYAPQVTPEAQFPFYAPQAISKVQPSSYAPQATPDSWPPSYGVCMEGSGKDSPTGTLSSPKHLRPKGQLQKEPPAGSCMLGGLSLQEVTSLAMEESQEAKSLHQPLGICTDRTSDPNVLHSGEEGTPQYLKGQLPLLSSVQIEGHPMSLPLQPPSRPCSPSDQGPSPWGLLESLVCPKDEAKSPAPETSDLEQPTELDSLFRGLALTVQWE

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • 6xHis and SUMO tag at the N-terminus
  • Protein Format
  • Soluble
  • Purity
  • >90% as determined by SDS-PAGE
  • Buffer
  • Tris-based buffer, 50% glycerol

Target

  • Target Protein
  • IL22RA1
  • Full Name
  • Interleukin 22 receptor subunit alpha 1
  • Introduction
  • The protein encoded by this gene belongs to the class II cytokine receptor family, and has been shown to be a receptor for interleukin 22 (IL22). IL22 receptor is a protein complex that consists of this protein and interleukin 10 receptor, beta (IL10BR/CRFB4), a subunit also shared by the receptor complex for interleukin 10 (IL10). This gene and interleukin 28 receptor, alpha (IL28RA) form a cytokine receptor gene cluster in the chromosomal region 1p36.
  • Alternative Names
  • IL22RA1; IL22R; CRF2-9; IL22R1; IL-22 receptor subunit alpha-1; IL-22R-alpha-1; IL-22RA1; cytokine receptor class-II member 9; cytokine receptor family 2 member 9; interleukin 22 receptor, alpha 1; zcytoR11; Interleukin 22 receptor subunit alpha 1

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us