Close

Magic™ Membrane Protein Human ITGA2B (Integrin subunit alpha 2b) Expressed in Yeast with 6xHis tag at the N-terminus for Antibody Discovery, Partial (639-887aa) (CAT#: MPX4360K)

This product is a 29.0kDa Human ITGA2B membrane protein expressed in Yeast. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • ITGA2B
  • Protein Length
  • Partial (639-887aa)
  • Protein Class
  • Cell adhesion
  • Molecular Weight
  • 29.0kDa
  • TMD
  • 1
  • Sequence
  • CVPQLQLTASVTGSPLLVGADNVLELQMDAANEGEGAYEAELAVHLPQGAHYMRALSNVEGFERLICNQKKENETRVVLCELGNPMKKNAQIGIAMLVSVGNLEEAGESVSFQLQIRSKNSQNPNSKIVLLDVPVRAEAQVELRGNSFPASLVVAAEEGEREQNSLDSWGPKVEHTYELHNNGPGTVNGLHLSIHLPGQSQPSDLLYILDIQPQGGLQCFPQPPVNPLKVDWGLPIPSPSPIHPAHHKR

Product Description

  • Expression Systems
  • Yeast
  • Tag
  • 6xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Purity
  • >90% as determined by SDS-PAGE
  • Buffer
  • Tris-based buffer, 50% glycerol

Target

  • Target Protein
  • ITGA2B
  • Full Name
  • Integrin subunit alpha 2b
  • Introduction
  • This gene encodes a member of the integrin alpha chain family of proteins. The encoded preproprotein is proteolytically processed to generate light and heavy chains that associate through disulfide linkages to form a subunit of the alpha-IIb/beta-3 integrin cell adhesion receptor. This receptor plays a crucial role in the blood coagulation system, by mediating platelet aggregation. Mutations in this gene are associated with platelet-type bleeding disorders, which are characterized by a failure of platelet aggregation, including Glanzmann thrombasthenia.
  • Alternative Names
  • ITGA2B; GT; GT1; GTA; CD41; GP2B; HPA3; CD41B; GPIIb; BDPLT2; BDPLT16; PPP1R93; integrin alpha-IIb; GPalpha IIb; alphaIIb protein; integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41); platelet fibrinogen receptor, alpha subunit; platelet glycoprotein IIb of IIb/IIIa complex; platelet membrane glycoprotein IIb; platelet-specific antigen BAK; protein phosphatase 1, regulatory subunit 93; Integrin subunit alpha 2b

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us